Viewing data for Crocodylus niloticus


Scientific name Crocodylus niloticus
Common name Nile crocodile
Maximum lifespan 43.80 years (Crocodylus niloticus@AnAge)

Total mtDNA (size: 16830 bases) GC AT G C A T
Base content (bases) 7299 9531 4778 2521 4168 5363
Base content per 1 kb (bases) 434 566 284 150 248 319
Base content (%) 43.4% 56.6%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 5029 6353 3458 1571 2881 3472
Base content per 1 kb (bases) 442 558 304 138 253 305
Base content (%) 44.2% 55.8%
D-loop (size: 1105 bases) GC AT G C A T
Base content (bases) 350 755 217 133 323 432
Base content per 1 kb (bases) 317 683 196 120 292 391
Base content (%) 31.7% 68.3%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 664 886 382 282 395 491
Base content per 1 kb (bases) 428 572 246 182 255 317
Base content (%) 42.8% 57.2%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1151 1426 640 511 538 888
Base content per 1 kb (bases) 447 553 248 198 209 345
Base content (%) 44.7% 55.3%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 462 522 254 208 201 321
Base content per 1 kb (bases) 470 530 258 211 204 326
Base content (%) 47.0% 53.0%
16S rRNA gene (size: 1593 bases) GC AT G C A T
Base content (bases) 689 904 386 303 337 567
Base content per 1 kb (bases) 433 567 242 190 212 356
Base content (%) 43.3% 56.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 299 385 215 84 170 215
Base content per 1 kb (bases) 437 563 314 123 249 314
Base content (%) 43.7% 56.3%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 57 105 43 14 39 66
Base content per 1 kb (bases) 352 648 265 86 241 407
Base content (%) 35.2% 64.8%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 666 891 416 250 436 455
Base content per 1 kb (bases) 428 572 267 161 280 292
Base content (%) 42.8% 57.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 287 397 195 92 165 232
Base content per 1 kb (bases) 420 580 285 135 241 339
Base content (%) 42.0% 58.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 361 423 234 127 207 216
Base content per 1 kb (bases) 460 540 298 162 264 276
Base content (%) 46.0% 54.0%
CYTB (size: 1156 bases) GC AT G C A T
Base content (bases) 532 624 362 170 293 331
Base content per 1 kb (bases) 460 540 313 147 253 286
Base content (%) 46.0% 54.0%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 438 525 292 146 259 266
Base content per 1 kb (bases) 455 545 303 152 269 276
Base content (%) 45.5% 54.5%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 469 587 343 126 266 321
Base content per 1 kb (bases) 444 556 325 119 252 304
Base content (%) 44.4% 55.6%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 164 184 104 60 89 95
Base content per 1 kb (bases) 471 529 299 172 256 273
Base content (%) 47.1% 52.9%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 584 790 412 172 353 437
Base content per 1 kb (bases) 425 575 300 125 257 318
Base content (%) 42.5% 57.5%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 133 161 96 37 84 77
Base content per 1 kb (bases) 452 548 327 126 286 262
Base content (%) 45.2% 54.8%
ND5 (size: 1855 bases) GC AT G C A T
Base content (bases) 836 1019 587 249 446 573
Base content per 1 kb (bases) 451 549 316 134 240 309
Base content (%) 45.1% 54.9%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 234 294 178 56 85 209
Base content per 1 kb (bases) 443 557 337 106 161 396
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 8 8 8 26 11 8 6 1 0 0 5 3 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 9 7 2 0 4 2 1 2 1 10 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 2 3 3 6 0 0 1 3 1 1 0 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 2 5 1 0 1 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 83 71 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 70 40 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 62 104 34
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMISSITWLVFVITLQPKIASMKFMNNPSNPNQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 4 (7.55%)
Threonine (Thr, T)
n = 5 (9.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.77%)
Leucine (Leu, L)
n = 4 (7.55%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 4 (7.55%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 2 (3.77%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 5 (9.43%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 0 0 1 0 3 3 1 1 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 0 2 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 1 1 0 0 1 0 0 2 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 4 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 13 24 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 13 27 9
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 47 (9.07%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 12 (2.32%)
Histidine (His, H)
n = 16 (3.09%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 26 8 12 24 1 6 9 3 9 7 18 5 20 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 7 16 13 0 1 12 26 4 2 8 18 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 4 2 8 15 2 1 7 7 10 0 3 8 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 5 9 10 0 1 1 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 112 147 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 97 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 171 211 105
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 10 2 5 16 3 5 7 3 2 4 6 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 2 2 5 1 1 1 5 1 2 4 8 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 3 3 6 0 1 3 6 3 0 0 3 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 1 1 9 3 0 0 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 65 67 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 73 102 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 14 (5.38%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 10 1 6 16 3 6 6 0 5 8 2 1 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 5 11 4 1 1 8 5 4 0 1 9 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 1 1 7 0 0 6 7 4 0 1 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 1 3 1 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 67 64 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 53 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 102 99 43
CYTB (size: 1156 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.25%)
Alanine (Ala, A)
n = 27 (7.03%)
Serine (Ser, S)
n = 25 (6.51%)
Threonine (Thr, T)
n = 28 (7.29%)
Cysteine (Cys, C)
n = 2 (0.52%)
Valine (Val, V)
n = 17 (4.43%)
Leucine (Leu, L)
n = 68 (17.71%)
Isoleucine (Ile, I)
n = 28 (7.29%)
Methionine (Met, M)
n = 16 (4.17%)
Proline (Pro, P)
n = 24 (6.25%)
Phenylalanine (Phe, F)
n = 28 (7.29%)
Tyrosine (Tyr, Y)
n = 15 (3.91%)
Tryptophan (Trp, W)
n = 12 (3.13%)
Aspartic acid (Asp, D)
n = 10 (2.6%)
Glutamic acid (Glu, E)
n = 6 (1.56%)
Asparagine (Asn, N)
n = 16 (4.17%)
Glutamine (Gln, Q)
n = 8 (2.08%)
Histidine (His, H)
n = 12 (3.13%)
Lysine (Lys, K)
n = 9 (2.34%)
Arginine (Arg, R)
n = 10 (2.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 13 9 7 35 8 8 5 3 2 6 6 3 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 4 13 9 1 0 4 16 4 2 5 12 5 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 3 2 9 10 1 0 3 2 13 1 1 1 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 8 9 0 0 3 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 113 100 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 101 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 148 155 47
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 29 (9.06%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 29 (9.06%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.0%)
Leucine (Leu, L)
n = 64 (20.0%)
Isoleucine (Ile, I)
n = 25 (7.81%)
Methionine (Met, M)
n = 11 (3.44%)
Proline (Pro, P)
n = 19 (5.94%)
Phenylalanine (Phe, F)
n = 20 (6.25%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 9 6 5 25 14 12 4 1 3 7 5 1 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 12 12 1 3 7 4 2 5 5 9 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 15 1 4 5 8 3 2 3 2 9 1 2 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 3 1 2 6 1 0 2 4 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 84 89 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 97 50 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 111 127 49
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 30 (8.55%)
Serine (Ser, S)
n = 30 (8.55%)
Threonine (Thr, T)
n = 47 (13.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (4.84%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 31 (8.83%)
Methionine (Met, M)
n = 12 (3.42%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 8 (2.28%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 13 (3.7%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 16 7 12 10 29 5 9 14 1 3 4 4 6 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 19 9 0 0 5 4 2 0 5 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 22 1 6 13 6 2 0 3 2 6 4 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 3 0 0 11 1 0 1 3 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 97 118 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 121 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 125 142 54
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 30 (8.55%)
Serine (Ser, S)
n = 30 (8.55%)
Threonine (Thr, T)
n = 47 (13.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (4.84%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 31 (8.83%)
Methionine (Met, M)
n = 12 (3.42%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 8 (2.28%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 13 (3.7%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 16 7 12 10 29 5 9 14 1 3 4 4 6 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 19 9 0 0 5 4 2 0 5 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 22 1 6 13 6 2 0 3 2 6 4 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 3 0 0 11 1 0 1 3 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 97 118 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 121 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 125 142 54
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.81%)
Alanine (Ala, A)
n = 32 (7.0%)
Serine (Ser, S)
n = 39 (8.53%)
Threonine (Thr, T)
n = 53 (11.6%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.72%)
Leucine (Leu, L)
n = 90 (19.69%)
Isoleucine (Ile, I)
n = 36 (7.88%)
Methionine (Met, M)
n = 33 (7.22%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 10 (2.19%)
Glutamine (Gln, Q)
n = 18 (3.94%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 27 11 11 40 7 20 18 0 2 4 11 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 5 2 17 11 2 2 8 10 2 1 9 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 24 3 1 14 13 1 1 9 3 10 5 1 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 1 6 8 0 0 1 7 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 128 150 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 136 74 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 148 213 67
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 21 (21.65%)
Isoleucine (Ile, I)
n = 8 (8.25%)
Methionine (Met, M)
n = 4 (4.12%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 7 (7.22%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 5 1 0 5 8 4 3 1 0 0 1 1 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 0 7 1 0 0 3 0 1 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 2 1 5 2 0 0 0 0 0 1 2 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 1 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 25 31 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 40 31 16
ND5 (size: 1855 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.05%)
Alanine (Ala, A)
n = 52 (8.43%)
Serine (Ser, S)
n = 64 (10.37%)
Threonine (Thr, T)
n = 63 (10.21%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 20 (3.24%)
Leucine (Leu, L)
n = 100 (16.21%)
Isoleucine (Ile, I)
n = 60 (9.72%)
Methionine (Met, M)
n = 37 (6.0%)
Proline (Pro, P)
n = 28 (4.54%)
Phenylalanine (Phe, F)
n = 29 (4.7%)
Tyrosine (Tyr, Y)
n = 17 (2.76%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 13 (2.11%)
Glutamic acid (Glu, E)
n = 15 (2.43%)
Asparagine (Asn, N)
n = 19 (3.08%)
Glutamine (Gln, Q)
n = 19 (3.08%)
Histidine (His, H)
n = 13 (2.11%)
Lysine (Lys, K)
n = 23 (3.73%)
Arginine (Arg, R)
n = 10 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 34 26 11 16 45 11 15 16 3 2 6 9 3 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 4 3 27 19 3 1 9 9 6 3 8 15 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 19 1 3 18 19 4 2 18 5 12 2 2 3 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 4 1 12 18 5 1 2 6 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 153 222 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 187 119 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 247 232 81
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 14 (8.0%)
Threonine (Thr, T)
n = 5 (2.86%)
Cysteine (Cys, C)
n = 7 (4.0%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 24 (13.71%)
Isoleucine (Ile, I)
n = 8 (4.57%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 4 (2.29%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 3 3 1 3 2 8 0 0 11 0 4 10 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 7 0 4 3 3 2 4 6 4 13 0 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 3 0 1 2 8 0 7 0 3 7 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 4 4 1 1 1 2 0 1 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 16 33 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 24 21 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 16 31 76
Total protein-coding genes (size: 11445 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.51%)
Alanine (Ala, A)
n = 291 (7.63%)
Serine (Ser, S)
n = 295 (7.74%)
Threonine (Thr, T)
n = 354 (9.28%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 197 (5.17%)
Leucine (Leu, L)
n = 640 (16.78%)
Isoleucine (Ile, I)
n = 299 (7.84%)
Methionine (Met, M)
n = 200 (5.25%)
Proline (Pro, P)
n = 200 (5.25%)
Phenylalanine (Phe, F)
n = 222 (5.82%)
Tyrosine (Tyr, Y)
n = 114 (2.99%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 71 (1.86%)
Glutamic acid (Glu, E)
n = 92 (2.41%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 107 (2.81%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 88 (2.31%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
140 159 146 73 90 280 72 107 90 17 40 50 74 33 81 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 13 16 35 145 98 13 14 68 87 41 18 51 114 17 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 150 17 32 77 98 18 16 54 44 70 22 18 34 96 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 72 20 16 55 79 9 5 16 42 8 0 2 7 1 78
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
861 987 1143 823
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
482 1070 704 1558
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
362 1298 1522 632

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.