Viewing data for Crocodylus palustris


Scientific name Crocodylus palustris
Common name Mugger or marsh crocodile
Maximum lifespan 31.50 years (Crocodylus palustris@AnAge)

Total mtDNA (size: 17052 bases) GC AT G C A T
Base content (bases) 7278 9774 4785 2493 4251 5523
Base content per 1 kb (bases) 427 573 281 146 249 324
Base content (%) 42.7% 57.3%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 4995 6387 3452 1543 2894 3493
Base content per 1 kb (bases) 439 561 303 136 254 307
Base content (%) 43.9% 56.1%
D-loop (size: 1333 bases) GC AT G C A T
Base content (bases) 369 964 222 147 403 561
Base content per 1 kb (bases) 277 723 167 110 302 421
Base content (%) 27.7% 72.3%
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 667 873 384 283 390 483
Base content per 1 kb (bases) 433 567 249 184 253 314
Base content (%) 43.3% 56.7%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1153 1424 654 499 527 897
Base content per 1 kb (bases) 447 553 254 194 205 348
Base content (%) 44.7% 55.3%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 469 515 261 208 195 320
Base content per 1 kb (bases) 477 523 265 211 198 325
Base content (%) 47.7% 52.3%
16S rRNA gene (size: 1593 bases) GC AT G C A T
Base content (bases) 684 909 393 291 332 577
Base content per 1 kb (bases) 429 571 247 183 208 362
Base content (%) 42.9% 57.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 295 389 211 84 169 220
Base content per 1 kb (bases) 431 569 308 123 247 322
Base content (%) 43.1% 56.9%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 61 101 43 18 40 61
Base content per 1 kb (bases) 377 623 265 111 247 377
Base content (%) 37.7% 62.3%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 659 898 420 239 434 464
Base content per 1 kb (bases) 423 577 270 154 279 298
Base content (%) 42.3% 57.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 294 390 200 94 161 229
Base content per 1 kb (bases) 430 570 292 137 235 335
Base content (%) 43.0% 57.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 360 424 236 124 201 223
Base content per 1 kb (bases) 459 541 301 158 256 284
Base content (%) 45.9% 54.1%
CYTB (size: 1156 bases) GC AT G C A T
Base content (bases) 524 632 367 157 293 339
Base content per 1 kb (bases) 453 547 317 136 253 293
Base content (%) 45.3% 54.7%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 444 519 293 151 256 263
Base content per 1 kb (bases) 461 539 304 157 266 273
Base content (%) 46.1% 53.9%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 462 594 338 124 271 323
Base content per 1 kb (bases) 438 563 320 117 257 306
Base content (%) 43.8% 56.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 155 193 98 57 92 101
Base content per 1 kb (bases) 445 555 282 164 264 290
Base content (%) 44.5% 55.5%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 592 782 416 176 350 432
Base content per 1 kb (bases) 431 569 303 128 255 314
Base content (%) 43.1% 56.9%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 133 161 99 34 84 77
Base content per 1 kb (bases) 452 548 337 116 286 262
Base content (%) 45.2% 54.8%
ND5 (size: 1855 bases) GC AT G C A T
Base content (bases) 809 1046 574 235 467 579
Base content per 1 kb (bases) 436 564 309 127 252 312
Base content (%) 43.6% 56.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 237 291 176 61 87 204
Base content per 1 kb (bases) 449 551 333 116 165 386
Base content (%) 44.9% 55.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 21 (9.25%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 4 (1.76%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 9 9 6 20 11 13 6 1 1 0 5 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 11 10 0 0 3 3 1 1 2 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 3 2 5 1 1 2 1 3 1 1 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 2 4 2 0 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 76 72 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 71 38 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 64 110 30
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMISSITWLVFIVTLQPKIASLKFMNNPSSPDQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 5 (9.43%)
Threonine (Thr, T)
n = 5 (9.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.77%)
Leucine (Leu, L)
n = 5 (9.43%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 2 (3.77%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 1 (1.89%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 3 (5.66%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 0 0 2 0 3 3 1 1 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 1 1 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 2 0 1 0 0 2 0 0 2 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 1 3 1 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 14 22 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 14 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 12 25 10
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 34 (6.56%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 32 (6.18%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 47 (9.07%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 12 (2.32%)
Histidine (His, H)
n = 16 (3.09%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 19 28 10 9 22 3 8 10 2 13 4 19 3 19 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 17 13 0 3 12 26 2 2 9 19 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 2 8 17 0 1 6 4 13 2 2 7 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 1 4 10 10 0 1 1 7 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 112 146 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 132 97 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 176 221 101
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 10 (4.41%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 9 3 5 12 6 4 7 2 2 5 6 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 1 3 5 0 1 0 4 2 2 3 10 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 1 5 5 0 0 6 5 4 0 2 2 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 3 7 3 0 0 3 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 67 69 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 56 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 77 99 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 11 12 3 4 18 4 3 5 1 3 7 3 1 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 6 10 3 1 1 6 10 2 0 0 12 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 0 0 2 7 1 0 6 4 7 2 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 1 2 2 1 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 69 66 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 52 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 103 105 38
CYTB (size: 1156 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.25%)
Alanine (Ala, A)
n = 27 (7.03%)
Serine (Ser, S)
n = 28 (7.29%)
Threonine (Thr, T)
n = 25 (6.51%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 14 (3.65%)
Leucine (Leu, L)
n = 70 (18.23%)
Isoleucine (Ile, I)
n = 29 (7.55%)
Methionine (Met, M)
n = 17 (4.43%)
Proline (Pro, P)
n = 24 (6.25%)
Phenylalanine (Phe, F)
n = 27 (7.03%)
Tyrosine (Tyr, Y)
n = 15 (3.91%)
Tryptophan (Trp, W)
n = 12 (3.13%)
Aspartic acid (Asp, D)
n = 11 (2.86%)
Glutamic acid (Glu, E)
n = 6 (1.56%)
Asparagine (Asn, N)
n = 15 (3.91%)
Glutamine (Gln, Q)
n = 8 (2.08%)
Histidine (His, H)
n = 12 (3.13%)
Lysine (Lys, K)
n = 9 (2.34%)
Arginine (Arg, R)
n = 11 (2.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 19 14 7 11 32 7 12 6 2 2 5 5 2 4 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 12 11 0 1 3 18 2 1 5 16 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 0 4 9 10 2 0 3 2 13 0 1 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 1 10 8 1 1 2 6 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 112 98 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 101 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 154 165 42
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 30 (9.38%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 28 (8.75%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 18 (5.63%)
Leucine (Leu, L)
n = 66 (20.63%)
Isoleucine (Ile, I)
n = 23 (7.19%)
Methionine (Met, M)
n = 11 (3.44%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 18 (5.63%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 7 5 7 32 11 9 6 0 5 7 4 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 15 11 0 2 7 5 2 2 7 7 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 1 5 3 10 2 3 2 4 7 3 2 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 4 1 2 6 1 1 1 4 1 0 1 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 89 86 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 96 51 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 108 126 51
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 31 (8.83%)
Serine (Ser, S)
n = 33 (9.4%)
Threonine (Thr, T)
n = 43 (12.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.56%)
Leucine (Leu, L)
n = 63 (17.95%)
Isoleucine (Ile, I)
n = 33 (9.4%)
Methionine (Met, M)
n = 13 (3.7%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 17 (4.84%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 20 9 8 10 28 4 12 11 4 2 3 6 5 2 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 18 10 0 0 6 4 1 2 3 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 7 13 7 2 1 3 3 6 1 1 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 2 0 1 10 2 0 2 3 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 90 116 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 128 147 50
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 31 (8.83%)
Serine (Ser, S)
n = 33 (9.4%)
Threonine (Thr, T)
n = 43 (12.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.56%)
Leucine (Leu, L)
n = 63 (17.95%)
Isoleucine (Ile, I)
n = 33 (9.4%)
Methionine (Met, M)
n = 13 (3.7%)
Proline (Pro, P)
n = 17 (4.84%)
Phenylalanine (Phe, F)
n = 17 (4.84%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 20 9 8 10 28 4 12 11 4 2 3 6 5 2 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 18 10 0 0 6 4 1 2 3 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 7 13 7 2 1 3 3 6 1 1 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 2 0 1 10 2 0 2 3 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 90 116 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 128 147 50
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.81%)
Alanine (Ala, A)
n = 33 (7.22%)
Serine (Ser, S)
n = 39 (8.53%)
Threonine (Thr, T)
n = 52 (11.38%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.72%)
Leucine (Leu, L)
n = 91 (19.91%)
Isoleucine (Ile, I)
n = 34 (7.44%)
Methionine (Met, M)
n = 33 (7.22%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 12 (2.63%)
Glutamine (Gln, Q)
n = 18 (3.94%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 24 11 13 34 9 21 16 2 2 4 9 2 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 5 2 17 11 3 2 8 12 0 2 8 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 1 3 10 16 1 0 9 3 10 3 3 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 1 5 8 0 1 0 8 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 126 148 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 137 75 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 153 209 61
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 11 (11.34%)
Threonine (Thr, T)
n = 10 (10.31%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 3 (3.09%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 7 (7.22%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 0 5 12 2 2 1 0 0 1 1 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 7 1 0 1 2 1 0 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 3 2 5 1 0 0 0 0 1 2 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 27 28 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 41 34 15
ND5 (size: 1855 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.05%)
Alanine (Ala, A)
n = 55 (8.91%)
Serine (Ser, S)
n = 57 (9.24%)
Threonine (Thr, T)
n = 63 (10.21%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 20 (3.24%)
Leucine (Leu, L)
n = 98 (15.88%)
Isoleucine (Ile, I)
n = 59 (9.56%)
Methionine (Met, M)
n = 36 (5.83%)
Proline (Pro, P)
n = 30 (4.86%)
Phenylalanine (Phe, F)
n = 31 (5.02%)
Tyrosine (Tyr, Y)
n = 17 (2.76%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 13 (2.11%)
Glutamic acid (Glu, E)
n = 15 (2.43%)
Asparagine (Asn, N)
n = 23 (3.73%)
Glutamine (Gln, Q)
n = 20 (3.24%)
Histidine (His, H)
n = 12 (1.94%)
Lysine (Lys, K)
n = 24 (3.89%)
Arginine (Arg, R)
n = 9 (1.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 31 25 9 17 42 11 14 16 4 3 3 11 3 10 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 4 10 24 21 0 3 8 12 2 7 8 12 3 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 17 1 4 17 20 2 0 14 2 15 1 5 7 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 3 2 11 23 1 0 3 5 1 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
128 150 219 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 191 124 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 233 236 101
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.57%)
Alanine (Ala, A)
n = 13 (7.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 6 (3.43%)
Cysteine (Cys, C)
n = 7 (4.0%)
Valine (Val, V)
n = 19 (10.86%)
Leucine (Leu, L)
n = 29 (16.57%)
Isoleucine (Ile, I)
n = 8 (4.57%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 4 (2.29%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 4 4 3 6 2 6 0 0 7 0 3 9 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 6 1 8 0 3 2 8 2 4 15 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 3 1 1 1 6 0 5 2 4 8 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 0 0 2 2 0 0 2 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 22 34 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 26 22 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 13 31 77
Total protein-coding genes (size: 11445 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.56%)
Alanine (Ala, A)
n = 298 (7.82%)
Serine (Ser, S)
n = 296 (7.76%)
Threonine (Thr, T)
n = 344 (9.02%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 184 (4.83%)
Leucine (Leu, L)
n = 649 (17.02%)
Isoleucine (Ile, I)
n = 301 (7.89%)
Methionine (Met, M)
n = 202 (5.3%)
Proline (Pro, P)
n = 201 (5.27%)
Phenylalanine (Phe, F)
n = 220 (5.77%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 72 (1.89%)
Glutamic acid (Glu, E)
n = 91 (2.39%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 108 (2.83%)
Histidine (His, H)
n = 92 (2.41%)
Lysine (Lys, K)
n = 89 (2.33%)
Arginine (Arg, R)
n = 74 (1.94%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
133 168 146 72 93 271 72 113 89 19 41 39 75 29 77 143
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 10 16 46 142 104 6 22 59 101 30 20 48 119 14 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
140 152 5 38 72 107 13 12 54 33 82 23 28 33 97 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
77 73 18 18 54 79 10 6 16 45 7 0 2 8 0 77
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
857 983 1134 840
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
480 1073 705 1556
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
332 1300 1559 623

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.