Viewing data for Aetobatus flagellum


Scientific name Aetobatus flagellum
Common name Longheaded eagle ray
Maximum lifespan 16.00 years (Aetobatus flagellum@AnAge)

Total mtDNA (size: 20201 bases) GC AT G C A T
Base content (bases) 8256 11945 5469 2787 5693 6252
Base content per 1 kb (bases) 409 591 271 138 282 309
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11408 bases) GC AT G C A T
Base content (bases) 4852 6556 3420 1432 3224 3332
Base content per 1 kb (bases) 425 575 300 126 283 292
Base content (%) 42.5% 57.5%
D-loop (size: 4490 bases) GC AT G C A T
Base content (bases) 1680 2810 1064 616 1374 1436
Base content per 1 kb (bases) 374 626 237 137 306 320
Base content (%) 37.4% 62.6%
Total tRNA-coding genes (size: 1556 bases) GC AT G C A T
Base content (bases) 600 956 346 254 432 524
Base content per 1 kb (bases) 386 614 222 163 278 337
Base content (%) 38.6% 61.4%
Total rRNA-coding genes (size: 2523 bases) GC AT G C A T
Base content (bases) 1045 1478 589 456 608 870
Base content per 1 kb (bases) 414 586 233 181 241 345
Base content (%) 41.4% 58.6%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 414 538 237 177 228 310
Base content per 1 kb (bases) 435 565 249 186 239 326
Base content (%) 43.5% 56.5%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 631 940 352 279 380 560
Base content per 1 kb (bases) 402 598 224 178 242 356
Base content (%) 40.2% 59.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 282 402 208 74 206 196
Base content per 1 kb (bases) 412 588 304 108 301 287
Base content (%) 41.2% 58.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 62 106 47 15 51 55
Base content per 1 kb (bases) 369 631 280 89 304 327
Base content (%) 36.9% 63.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 668 886 399 269 478 408
Base content per 1 kb (bases) 430 570 257 173 308 263
Base content (%) 43.0% 57.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 277 414 178 99 200 214
Base content per 1 kb (bases) 401 599 258 143 289 310
Base content (%) 40.1% 59.9%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 359 427 235 124 217 210
Base content per 1 kb (bases) 457 543 299 158 276 267
Base content (%) 45.7% 54.3%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 501 642 367 134 325 317
Base content per 1 kb (bases) 438 562 321 117 284 277
Base content (%) 43.8% 56.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 433 542 314 119 264 278
Base content per 1 kb (bases) 444 556 322 122 271 285
Base content (%) 44.4% 55.6%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 433 614 332 101 270 344
Base content per 1 kb (bases) 414 586 317 96 258 329
Base content (%) 41.4% 58.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 157 192 109 48 108 84
Base content per 1 kb (bases) 450 550 312 138 309 241
Base content (%) 45.0% 55.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 590 791 432 158 390 401
Base content per 1 kb (bases) 427 573 313 114 282 290
Base content (%) 42.7% 57.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 124 173 85 39 103 70
Base content per 1 kb (bases) 418 582 286 131 347 236
Base content (%) 41.8% 58.2%
ND5 (size: 1833 bases) GC AT G C A T
Base content (bases) 743 1090 540 203 535 555
Base content per 1 kb (bases) 405 595 295 111 292 303
Base content (%) 40.5% 59.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 229 293 177 52 83 210
Base content per 1 kb (bases) 439 561 339 100 159 402
Base content (%) 43.9% 56.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 51 (22.47%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 9 11 7 23 3 6 10 0 4 3 4 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 10 4 0 1 3 3 1 2 7 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 1 2 3 1 0 5 2 2 0 1 4 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 0 1 0 0 1 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 78 71 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 66 92 59
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFLIFLFTWLFFLTIMPNKVMSHYYNNSPNVKDSPMPESNPWNWPWA*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 1 1 2 0 1 1 0 0 0 2 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 1 0 0 0 0 0 0 4 1 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 1 1 2 0 0 1 0 0 2 0 0 3 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 15 18 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 16 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 16 21 16
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 44 (8.51%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 35 (6.77%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 63 (12.19%)
Isoleucine (Ile, I)
n = 43 (8.32%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 30 (5.8%)
Phenylalanine (Phe, F)
n = 40 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 16 (3.09%)
Glutamine (Gln, Q)
n = 10 (1.93%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 22 20 12 12 21 6 10 7 3 16 7 14 2 22 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 6 17 21 0 15 11 10 10 4 8 15 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 1 9 5 9 2 2 2 8 11 2 2 11 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 0 7 7 8 0 2 0 4 2 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 118 131 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 98 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 147 179 153
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 14 (6.11%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 25 (10.92%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 10 (4.37%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 7 7 2 6 1 10 9 1 4 9 5 0 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 4 8 0 1 3 4 0 8 0 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 8 0 3 7 2 0 0 3 6 3 0 0 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 15 1 3 9 4 0 0 5 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 55 60 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 52 66 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 71 88 64
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 20 (7.66%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 18 (6.9%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 7 4 6 14 3 5 9 0 6 5 5 0 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 13 5 0 3 9 8 1 3 5 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 0 2 8 1 1 2 2 9 1 0 1 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 3 1 2 0 0 0 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 70 54 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 99 100 55
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.79%)
Alanine (Ala, A)
n = 22 (5.79%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 30 (7.89%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 59 (15.53%)
Isoleucine (Ile, I)
n = 42 (11.05%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 10 (2.63%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 26 8 10 18 22 1 7 7 1 2 7 6 2 11 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 4 13 5 0 5 8 8 1 4 8 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 11 0 4 8 6 2 0 2 3 11 0 1 6 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 3 7 10 0 0 3 5 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 102 113 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 96 78 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 169 126 76
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.94%)
Alanine (Ala, A)
n = 28 (8.64%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 28 (8.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.32%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 21 (6.48%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 15 12 7 11 29 5 14 5 1 0 9 5 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 15 9 0 3 8 3 2 5 5 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 9 1 6 5 6 0 1 3 4 8 0 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 1 0 3 7 0 1 2 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 92 89 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 95 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 127 133 53
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.31%)
Alanine (Ala, A)
n = 24 (6.9%)
Serine (Ser, S)
n = 29 (8.33%)
Threonine (Thr, T)
n = 44 (12.64%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 70 (20.11%)
Isoleucine (Ile, I)
n = 33 (9.48%)
Methionine (Met, M)
n = 22 (6.32%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.31%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 8 (2.3%)
Lysine (Lys, K)
n = 10 (2.87%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 18 9 20 22 6 12 12 1 2 2 2 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 6 11 7 0 1 4 9 1 4 6 7 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 27 2 3 9 13 0 0 4 3 6 0 1 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 1 10 0 1 2 1 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 101 128 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 112 61 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 119 155 58
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.31%)
Alanine (Ala, A)
n = 24 (6.9%)
Serine (Ser, S)
n = 29 (8.33%)
Threonine (Thr, T)
n = 44 (12.64%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 70 (20.11%)
Isoleucine (Ile, I)
n = 33 (9.48%)
Methionine (Met, M)
n = 22 (6.32%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.31%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 8 (2.3%)
Lysine (Lys, K)
n = 10 (2.87%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 18 9 20 22 6 12 12 1 2 2 2 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 6 11 7 0 1 4 9 1 4 6 7 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 27 2 3 9 13 0 0 4 3 6 0 1 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 1 10 0 1 2 1 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 101 128 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 112 61 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 119 155 58
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.36%)
Alanine (Ala, A)
n = 31 (6.75%)
Serine (Ser, S)
n = 39 (8.5%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 12 (2.61%)
Leucine (Leu, L)
n = 90 (19.61%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 18 (3.92%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 23 25 22 20 31 5 11 12 0 4 4 3 1 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 6 16 9 0 3 8 8 1 4 7 16 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 2 6 15 9 0 2 7 7 6 1 1 9 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 3 0 4 8 1 2 4 5 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 141 148 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 132 78 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 159 175 108
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 4 4 2 7 1 5 0 0 0 1 2 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 5 5 1 0 2 1 1 0 0 0 1 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 6 3 5 0 0 1 0 0 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 1 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 25 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 34 11 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 29 34 31
ND5 (size: 1833 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.59%)
Alanine (Ala, A)
n = 46 (7.54%)
Serine (Ser, S)
n = 52 (8.52%)
Threonine (Thr, T)
n = 52 (8.52%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 15 (2.46%)
Leucine (Leu, L)
n = 110 (18.03%)
Isoleucine (Ile, I)
n = 59 (9.67%)
Methionine (Met, M)
n = 26 (4.26%)
Proline (Pro, P)
n = 29 (4.75%)
Phenylalanine (Phe, F)
n = 41 (6.72%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 12 (1.97%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 33 (5.41%)
Glutamine (Gln, Q)
n = 21 (3.44%)
Histidine (His, H)
n = 13 (2.13%)
Lysine (Lys, K)
n = 23 (3.77%)
Arginine (Arg, R)
n = 8 (1.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 24 20 25 19 45 5 15 19 2 5 4 5 1 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 13 22 10 1 4 13 8 3 5 9 15 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 1 10 13 16 1 3 9 7 6 1 1 10 23 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 2 3 9 22 1 1 2 5 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 165 205 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 167 126 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 208 224 154
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 14 (8.09%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 4 1 0 1 2 8 0 0 9 2 6 5 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 5 1 6 3 9 2 5 13 3 0 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 6 0 2 1 5 0 6 1 2 19 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 3 0 0 0 1 0 1 2 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 13 22 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 32 17 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 7 44 67
Total protein-coding genes (size: 11430 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.83%)
Alanine (Ala, A)
n = 288 (7.56%)
Serine (Ser, S)
n = 273 (7.17%)
Threonine (Thr, T)
n = 309 (8.11%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 177 (4.65%)
Leucine (Leu, L)
n = 650 (17.07%)
Isoleucine (Ile, I)
n = 330 (8.67%)
Methionine (Met, M)
n = 177 (4.65%)
Proline (Pro, P)
n = 219 (5.75%)
Phenylalanine (Phe, F)
n = 236 (6.2%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 69 (1.81%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 143 (3.76%)
Glutamine (Gln, Q)
n = 102 (2.68%)
Histidine (His, H)
n = 101 (2.65%)
Lysine (Lys, K)
n = 78 (2.05%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
170 160 139 119 126 229 39 108 93 9 54 53 59 11 112 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 12 13 62 132 89 5 50 71 68 33 48 61 100 10 51
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
122 127 9 55 73 82 8 16 39 49 66 7 29 55 88 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 84 10 24 45 76 2 8 22 35 6 0 0 9 1 113
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
850 1006 1092 861
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
493 1034 712 1570
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
217 1258 1411 923

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.