Viewing data for Anas acuta


Scientific name Anas acuta
Common name Northern pintail
Maximum lifespan 27.40 years (Anas acuta@AnAge)

Total mtDNA (size: 16599 bases) GC AT G C A T
Base content (bases) 8150 8449 5455 2695 3672 4777
Base content per 1 kb (bases) 491 509 329 162 221 288
Base content (%) 49.1% 50.9%
Total protein-coding genes (size: 11387 bases) GC AT G C A T
Base content (bases) 5738 5649 4022 1716 2513 3136
Base content per 1 kb (bases) 504 496 353 151 221 275
Base content (%) 50.4% 49.6%
D-loop (size: 1044 bases) GC AT G C A T
Base content (bases) 488 556 320 168 268 288
Base content per 1 kb (bases) 467 533 307 161 257 276
Base content (%) 46.7% 53.3%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 682 864 402 280 373 491
Base content per 1 kb (bases) 441 559 260 181 241 318
Base content (%) 44.1% 55.9%
Total rRNA-coding genes (size: 2589 bases) GC AT G C A T
Base content (bases) 1219 1370 690 529 511 859
Base content per 1 kb (bases) 471 529 267 204 197 332
Base content (%) 47.1% 52.9%
12S rRNA gene (size: 986 bases) GC AT G C A T
Base content (bases) 489 497 283 206 184 313
Base content per 1 kb (bases) 496 504 287 209 187 317
Base content (%) 49.6% 50.4%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 730 873 407 323 327 546
Base content per 1 kb (bases) 455 545 254 201 204 341
Base content (%) 45.5% 54.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 344 340 260 84 150 190
Base content per 1 kb (bases) 503 497 380 123 219 278
Base content (%) 50.3% 49.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 63 13 32 60
Base content per 1 kb (bases) 452 548 375 77 190 357
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 792 759 511 281 368 391
Base content per 1 kb (bases) 511 489 329 181 237 252
Base content (%) 51.1% 48.9%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 341 346 224 117 152 194
Base content per 1 kb (bases) 496 504 326 170 221 282
Base content (%) 49.6% 50.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 403 381 273 130 179 202
Base content per 1 kb (bases) 514 486 348 166 228 258
Base content (%) 51.4% 48.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 574 569 401 173 274 295
Base content per 1 kb (bases) 502 498 351 151 240 258
Base content (%) 50.2% 49.8%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 495 483 335 160 235 248
Base content per 1 kb (bases) 506 494 343 164 240 254
Base content (%) 50.6% 49.4%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 518 521 385 133 218 303
Base content per 1 kb (bases) 499 501 371 128 210 292
Base content (%) 49.9% 50.1%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 177 175 121 56 87 88
Base content per 1 kb (bases) 503 497 344 159 247 250
Base content (%) 50.3% 49.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 681 697 493 188 313 384
Base content per 1 kb (bases) 494 506 358 136 227 279
Base content (%) 49.4% 50.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 161 136 106 55 67 69
Base content per 1 kb (bases) 542 458 357 185 226 232
Base content (%) 54.2% 45.8%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 907 917 650 257 390 527
Base content per 1 kb (bases) 497 503 356 141 214 289
Base content (%) 49.7% 50.3%
ND6 (size: 521 bases) GC AT G C A T
Base content (bases) 274 247 203 71 52 195
Base content per 1 kb (bases) 526 474 390 136 100 374
Base content (%) 52.6% 47.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 19 7 6 13 21 15 5 5 2 1 2 2 1 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 12 5 1 0 5 2 0 0 8 7 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 1 6 4 0 0 5 1 3 1 1 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 4 0 0 1 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 88 70 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 106 84 11
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALLIQPKLLTFTTTNPPSKKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 0 3 3 1 1 2 0 0 1 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 1 3 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 0 0 2 1 0 0 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 21 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 9 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 30 4
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 34 13 7 16 26 10 3 7 3 3 14 11 6 11 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 1 4 33 9 0 3 15 18 11 3 14 12 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 2 3 10 9 2 0 3 3 14 0 1 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 8 2 3 12 9 0 0 1 5 2 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 126 134 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 246 162 57
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 8 (3.51%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 7 0 12 10 5 3 5 2 4 4 6 4 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 11 3 0 0 3 4 2 2 4 6 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 2 5 9 2 0 3 1 8 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 14 0 1 12 2 2 0 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 62 50 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 102 82 23
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 13 7 0 12 14 3 3 5 1 3 7 4 1 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 13 5 1 0 9 9 1 1 5 4 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 1 5 5 2 0 5 0 9 0 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 6 2 0 5 4 0 0 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 70 58 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 134 90 20
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 23 4 7 17 27 8 4 6 2 1 7 6 5 5 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 5 3 18 8 0 0 10 10 4 2 8 13 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 2 3 9 8 3 0 2 3 10 1 1 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 2 0 7 9 1 0 3 4 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 111 95 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 188 122 34
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 19 (5.85%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 16 (4.92%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 14 11 0 19 26 11 3 6 0 1 8 6 4 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 21 10 0 1 5 4 4 4 15 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 2 1 9 8 3 0 6 4 10 2 2 0 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 5 2 1 0 6 1 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 97 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 141 113 31
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 22 13 6 17 34 8 2 6 3 0 8 3 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 19 15 2 0 6 4 1 3 9 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 4 11 9 1 1 6 0 7 5 0 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 1 0 10 4 1 1 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 111 109 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 151 136 27
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 22 13 6 17 34 8 2 6 3 0 8 3 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 19 15 2 0 6 4 1 3 9 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 4 11 9 1 1 6 0 7 5 0 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 1 0 10 4 1 1 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 111 109 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 151 136 27
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 48 (10.48%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 10 (2.18%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 29 15 8 23 44 16 10 7 4 0 5 4 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 3 0 22 10 0 1 7 8 4 0 15 10 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 19 2 3 13 11 2 2 8 2 12 3 1 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 5 1 2 8 2 0 2 7 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 156 143 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 138 73 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 199 168 36
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 1 3 8 5 0 2 0 0 0 2 2 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 0 6 3 0 0 4 1 1 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 3 5 0 0 4 0 1 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 0 3 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 30 24 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 48 29 6
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 58 (9.56%)
Serine (Ser, S)
n = 42 (6.92%)
Threonine (Thr, T)
n = 68 (11.2%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 20 (3.29%)
Leucine (Leu, L)
n = 107 (17.63%)
Isoleucine (Ile, I)
n = 50 (8.24%)
Methionine (Met, M)
n = 26 (4.28%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 33 (5.44%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 23 (3.79%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 41 17 6 30 50 14 7 15 4 1 5 11 3 12 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 6 5 35 16 2 1 13 16 3 0 16 14 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 21 1 2 19 7 2 0 12 2 9 6 0 5 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 7 2 4 23 0 0 7 3 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
131 174 202 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 187 111 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 289 214 53
ND6 (size: 521 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 15 (8.72%)
Serine (Ser, S)
n = 12 (6.98%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 36 (20.93%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 13 (7.56%)
Tyrosine (Tyr, Y)
n = 6 (3.49%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 6 0 1 5 5 0 1 12 4 8 12 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 4 3 4 4 3 2 0 22 3 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 0 5 1 2 4 2 1 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 1 0 0 0 0 0 6 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 23 16 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 32 14 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
77 16 21 59
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.84%)
Alanine (Ala, A)
n = 333 (8.77%)
Serine (Ser, S)
n = 284 (7.48%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 197 (5.19%)
Leucine (Leu, L)
n = 669 (17.61%)
Isoleucine (Ile, I)
n = 276 (7.27%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 118 (3.11%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
61 215 101 48 173 279 104 47 69 23 26 66 64 41 58 163
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
63 2 27 30 199 94 10 9 80 78 55 19 104 92 16 34
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
146 121 13 27 91 81 24 4 57 20 87 21 18 14 104 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
100 66 30 10 52 78 12 2 20 36 15 0 2 7 0 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
910 1107 1025 758
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
493 1101 679 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
447 1684 1298 371

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.