Viewing data for Anthropoides virgo


Scientific name Anthropoides virgo
Common name Demoiselle crane
Maximum lifespan 27.00 years (Anthropoides virgo@AnAge)

Total mtDNA (size: 16541 bases) GC AT G C A T
Base content (bases) 7374 9167 5116 2258 3998 5169
Base content per 1 kb (bases) 446 554 309 137 242 312
Base content (%) 44.6% 55.4%
Total protein-coding genes (size: 11361 bases) GC AT G C A T
Base content (bases) 5123 6238 3762 1361 2739 3499
Base content per 1 kb (bases) 451 549 331 120 241 308
Base content (%) 45.1% 54.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 655 895 390 265 388 507
Base content per 1 kb (bases) 423 577 252 171 250 327
Base content (%) 42.3% 57.7%
Total rRNA-coding genes (size: 2563 bases) GC AT G C A T
Base content (bases) 1169 1394 687 482 538 856
Base content per 1 kb (bases) 456 544 268 188 210 334
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 969 bases) GC AT G C A T
Base content (bases) 468 501 279 189 190 311
Base content per 1 kb (bases) 483 517 288 195 196 321
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1594 bases) GC AT G C A T
Base content (bases) 701 893 408 293 348 545
Base content per 1 kb (bases) 440 560 256 184 218 342
Base content (%) 44.0% 56.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 291 393 228 63 179 214
Base content per 1 kb (bases) 425 575 333 92 262 313
Base content (%) 42.5% 57.5%
ATP8 (size: 174 bases) GC AT G C A T
Base content (bases) 73 101 65 8 43 58
Base content per 1 kb (bases) 420 580 374 46 247 333
Base content (%) 42.0% 58.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 726 825 476 250 394 431
Base content per 1 kb (bases) 468 532 307 161 254 278
Base content (%) 46.8% 53.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 215 98 164 207
Base content per 1 kb (bases) 458 542 314 143 240 303
Base content (%) 45.8% 54.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 367 417 251 116 196 221
Base content per 1 kb (bases) 468 532 320 148 250 282
Base content (%) 46.8% 53.2%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 530 613 390 140 290 323
Base content per 1 kb (bases) 464 536 341 122 254 283
Base content (%) 46.4% 53.6%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 445 521 320 125 251 270
Base content per 1 kb (bases) 461 539 331 129 260 280
Base content (%) 46.1% 53.9%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 430 609 327 103 266 343
Base content per 1 kb (bases) 414 586 315 99 256 330
Base content (%) 41.4% 58.6%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 156 196 118 38 91 105
Base content per 1 kb (bases) 443 557 335 108 259 298
Base content (%) 44.3% 55.7%
ND4 (size: 1368 bases) GC AT G C A T
Base content (bases) 620 748 479 141 315 433
Base content per 1 kb (bases) 453 547 350 103 230 317
Base content (%) 45.3% 54.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 131 166 94 37 75 91
Base content per 1 kb (bases) 441 559 316 125 253 306
Base content (%) 44.1% 55.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 794 1021 599 195 422 599
Base content per 1 kb (bases) 437 563 330 107 233 330
Base content (%) 43.7% 56.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 250 272 201 49 59 213
Base content per 1 kb (bases) 479 521 385 94 113 408
Base content (%) 47.9% 52.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 26 (11.45%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 8 7 13 28 2 9 7 1 2 2 3 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 3 6 4 0 0 2 6 0 3 3 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 0 5 6 0 0 4 0 3 0 0 2 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 4 0 2 2 1 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 84 72 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 77 107 37
ATP8 (size: 174 bases)
Amino acid sequence: MPQLNPSPWFFIMLTSWLTFSLIIQPKLLSFTPTNPLSNLLSPTTTTKTTPWTWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (10.53%)
Threonine (Thr, T)
n = 11 (19.3%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (15.79%)
Isoleucine (Ile, I)
n = 4 (7.02%)
Methionine (Met, M)
n = 2 (3.51%)
Proline (Pro, P)
n = 9 (15.79%)
Phenylalanine (Phe, F)
n = 4 (7.02%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (8.77%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.26%)
Glutamine (Gln, Q)
n = 2 (3.51%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.51%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 2 1 5 1 0 2 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 3 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 1 1 3 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 20 23 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 25 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 20 27 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 25 21 5 13 29 4 10 9 0 1 15 17 2 10 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 11 22 12 0 5 17 20 5 4 6 20 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 1 3 11 9 0 0 4 7 10 2 1 6 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 10 0 3 12 9 0 0 2 6 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 118 135 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 218 202 77
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 16 7 3 9 14 2 3 7 0 4 6 4 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 6 2 6 0 0 2 3 3 3 5 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 0 9 7 0 1 1 2 6 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 2 7 6 4 0 0 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 62 57 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 93 88 36
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 19 (7.31%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 7 1 7 18 2 4 7 1 0 7 6 0 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 11 7 0 2 5 12 1 5 4 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 0 8 6 1 1 4 2 6 1 0 2 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 0 4 3 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 73 58 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 111 108 35
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 69 (18.16%)
Isoleucine (Ile, I)
n = 25 (6.58%)
Methionine (Met, M)
n = 12 (3.16%)
Proline (Pro, P)
n = 26 (6.84%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 20 8 9 18 36 0 6 8 0 4 5 7 1 5 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 7 13 6 0 2 12 8 3 1 11 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 10 1 2 9 11 0 0 1 4 10 1 0 3 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 4 2 10 0 2 2 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 117 98 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 170 146 55
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.05%)
Alanine (Ala, A)
n = 29 (9.03%)
Serine (Ser, S)
n = 27 (8.41%)
Threonine (Thr, T)
n = 21 (6.54%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.43%)
Leucine (Leu, L)
n = 61 (19.0%)
Isoleucine (Ile, I)
n = 28 (8.72%)
Methionine (Met, M)
n = 15 (4.67%)
Proline (Pro, P)
n = 25 (7.79%)
Phenylalanine (Phe, F)
n = 17 (5.3%)
Tyrosine (Tyr, Y)
n = 15 (4.67%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 11 (3.43%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 9 (2.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 13 9 13 27 5 5 5 0 3 1 7 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 13 13 0 3 7 0 3 5 8 12 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 1 13 7 0 1 5 3 12 1 2 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 3 7 0 2 1 4 2 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 96 89 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 96 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 128 125 50
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 45 (13.04%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 24 14 6 16 26 4 12 8 2 0 1 4 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 10 14 0 0 7 3 3 2 7 9 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 3 2 8 17 0 1 3 3 4 2 0 5 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 14 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 93 128 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 118 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 116 156 55
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 45 (13.04%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 24 14 6 16 26 4 12 8 2 0 1 4 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 10 14 0 0 7 3 3 2 7 9 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 3 2 8 17 0 1 3 3 4 2 0 5 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 14 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 93 128 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 118 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 116 156 55
ND4 (size: 1368 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.18%)
Alanine (Ala, A)
n = 29 (6.37%)
Serine (Ser, S)
n = 34 (7.47%)
Threonine (Thr, T)
n = 55 (12.09%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 8 (1.76%)
Leucine (Leu, L)
n = 100 (21.98%)
Isoleucine (Ile, I)
n = 40 (8.79%)
Methionine (Met, M)
n = 24 (5.27%)
Proline (Pro, P)
n = 27 (5.93%)
Phenylalanine (Phe, F)
n = 15 (3.3%)
Tyrosine (Tyr, Y)
n = 11 (2.42%)
Tryptophan (Trp, W)
n = 12 (2.64%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.2%)
Asparagine (Asn, N)
n = 13 (2.86%)
Glutamine (Gln, Q)
n = 15 (3.3%)
Histidine (His, H)
n = 18 (3.96%)
Lysine (Lys, K)
n = 9 (1.98%)
Arginine (Arg, R)
n = 11 (2.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 33 21 4 28 51 5 12 13 2 1 3 4 0 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 12 14 0 1 12 2 4 4 6 17 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 21 1 2 11 11 0 2 8 3 8 1 0 1 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 1 1 1 9 0 1 3 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 159 152 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 135 78 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 185 203 51
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 6 1 0 12 0 5 2 0 0 0 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 5 5 0 2 1 1 0 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 0 5 6 0 0 4 0 2 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 26 24 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 39 49 8
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.46%)
Alanine (Ala, A)
n = 46 (7.62%)
Serine (Ser, S)
n = 47 (7.78%)
Threonine (Thr, T)
n = 79 (13.08%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 12 (1.99%)
Leucine (Leu, L)
n = 102 (16.89%)
Isoleucine (Ile, I)
n = 52 (8.61%)
Methionine (Met, M)
n = 34 (5.63%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 28 (4.64%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 22 (3.64%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 37 31 8 31 42 4 16 17 3 2 6 4 0 6 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 9 25 11 1 2 12 17 2 2 7 16 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 35 0 3 19 15 0 0 10 5 8 1 1 6 22 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 13 0 2 5 22 0 1 3 3 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 154 225 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 188 119 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 257 255 76
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 34 (19.65%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 4 0 1 3 2 0 0 15 0 8 11 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 2 1 2 0 4 5 3 0 2 21 2 0 0 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 7 0 1 2 3 0 6 2 3 17 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 4 0 0 0 2 0 1 3 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 18 19 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 28 18 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
80 3 22 69
Total protein-coding genes (size: 11378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.83%)
Alanine (Ala, A)
n = 276 (7.28%)
Serine (Ser, S)
n = 284 (7.49%)
Threonine (Thr, T)
n = 362 (9.55%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 161 (4.25%)
Leucine (Leu, L)
n = 662 (17.46%)
Isoleucine (Ile, I)
n = 299 (7.89%)
Methionine (Met, M)
n = 178 (4.7%)
Proline (Pro, P)
n = 220 (5.8%)
Phenylalanine (Phe, F)
n = 220 (5.8%)
Tyrosine (Tyr, Y)
n = 108 (2.85%)
Tryptophan (Trp, W)
n = 108 (2.85%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 95 (2.51%)
Asparagine (Asn, N)
n = 130 (3.43%)
Glutamine (Gln, Q)
n = 98 (2.59%)
Histidine (His, H)
n = 114 (3.01%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
84 215 140 60 158 303 33 86 88 10 33 46 67 15 66 154
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 11 14 50 121 99 6 20 80 76 45 34 63 117 6 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
154 148 7 21 103 102 3 9 46 36 72 12 22 33 97 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 88 7 23 40 85 0 10 17 38 7 1 2 6 2 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 1058 1112 806
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
484 1087 701 1520
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
215 1466 1540 571

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.