Viewing data for Trimeresurus albolabris


Scientific name Trimeresurus albolabris
Common name White-lipped tree viper
Maximum lifespan 11.40 years (Trimeresurus albolabris@AnAge)

Total mtDNA (size: 17220 bases) GC AT G C A T
Base content (bases) 6812 10408 4698 2114 4657 5751
Base content per 1 kb (bases) 396 604 273 123 270 334
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11284 bases) GC AT G C A T
Base content (bases) 4487 6797 3251 1236 3015 3782
Base content per 1 kb (bases) 398 602 288 110 267 335
Base content (%) 39.8% 60.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1429 bases) GC AT G C A T
Base content (bases) 586 843 349 237 357 486
Base content per 1 kb (bases) 410 590 244 166 250 340
Base content (%) 41.0% 59.0%
Total rRNA-coding genes (size: 2385 bases) GC AT G C A T
Base content (bases) 951 1434 562 389 530 904
Base content per 1 kb (bases) 399 601 236 163 222 379
Base content (%) 39.9% 60.1%
12S rRNA gene (size: 907 bases) GC AT G C A T
Base content (bases) 380 527 227 153 190 337
Base content per 1 kb (bases) 419 581 250 169 209 372
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1478 bases) GC AT G C A T
Base content (bases) 571 907 335 236 340 567
Base content per 1 kb (bases) 386 614 227 160 230 384
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 264 417 205 59 190 227
Base content per 1 kb (bases) 388 612 301 87 279 333
Base content (%) 38.8% 61.2%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 55 110 42 13 44 66
Base content per 1 kb (bases) 333 667 255 79 267 400
Base content (%) 33.3% 66.7%
COX1 (size: 1602 bases) GC AT G C A T
Base content (bases) 683 919 438 245 455 464
Base content per 1 kb (bases) 426 574 273 153 284 290
Base content (%) 42.6% 57.4%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 311 374 204 107 156 218
Base content per 1 kb (bases) 454 546 298 156 228 318
Base content (%) 45.4% 54.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 332 452 210 122 211 241
Base content per 1 kb (bases) 423 577 268 156 269 307
Base content (%) 42.3% 57.7%
CYTB (size: 1114 bases) GC AT G C A T
Base content (bases) 444 670 333 111 331 339
Base content per 1 kb (bases) 399 601 299 100 297 304
Base content (%) 39.9% 60.1%
ND1 (size: 961 bases) GC AT G C A T
Base content (bases) 393 568 290 103 259 309
Base content per 1 kb (bases) 409 591 302 107 270 322
Base content (%) 40.9% 59.1%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 399 631 312 87 251 380
Base content per 1 kb (bases) 387 613 303 84 244 369
Base content (%) 38.7% 61.3%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 137 206 100 37 92 114
Base content per 1 kb (bases) 399 601 292 108 268 332
Base content (%) 39.9% 60.1%
ND4 (size: 1338 bases) GC AT G C A T
Base content (bases) 524 814 396 128 350 464
Base content per 1 kb (bases) 392 608 296 96 262 347
Base content (%) 39.2% 60.8%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 108 183 76 32 88 95
Base content per 1 kb (bases) 371 629 261 110 302 326
Base content (%) 37.1% 62.9%
ND5 (size: 1788 bases) GC AT G C A T
Base content (bases) 645 1143 484 161 509 634
Base content per 1 kb (bases) 361 639 271 90 285 355
Base content (%) 36.1% 63.9%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 195 324 163 32 83 241
Base content per 1 kb (bases) 376 624 314 62 160 464
Base content (%) 37.6% 62.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.65%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 18 (7.96%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.21%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 2 (0.88%)
Lysine (Lys, K)
n = 7 (3.1%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 10 13 7 7 29 2 6 6 1 3 4 3 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 5 5 0 0 2 4 0 3 5 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 3 6 2 0 2 5 1 4 0 0 4 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 7 0 1 0 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 71 84 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 63 39 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 71 104 48
ATP8 (size: 165 bases)
Amino acid sequence: MPQLDIVYIFLVYLWVWLTIVLMTLKIKTLTLTAKPKKQPLPKIKPTTLPTPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 9 (16.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.41%)
Leucine (Leu, L)
n = 10 (18.52%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 3 (5.56%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 7 (12.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 1 1 0 4 1 4 2 0 1 2 1 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 1 3 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 0 0 0 0 0 0 1 1 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 15 23 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 17 13 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 10 30 11
COX1 (size: 1602 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.44%)
Alanine (Ala, A)
n = 35 (6.57%)
Serine (Ser, S)
n = 34 (6.38%)
Threonine (Thr, T)
n = 46 (8.63%)
Cysteine (Cys, C)
n = 3 (0.56%)
Valine (Val, V)
n = 31 (5.82%)
Leucine (Leu, L)
n = 60 (11.26%)
Isoleucine (Ile, I)
n = 44 (8.26%)
Methionine (Met, M)
n = 32 (6.0%)
Proline (Pro, P)
n = 34 (6.38%)
Phenylalanine (Phe, F)
n = 43 (8.07%)
Tyrosine (Tyr, Y)
n = 19 (3.56%)
Tryptophan (Trp, W)
n = 19 (3.56%)
Aspartic acid (Asp, D)
n = 13 (2.44%)
Glutamic acid (Glu, E)
n = 8 (1.5%)
Asparagine (Asn, N)
n = 18 (3.38%)
Glutamine (Gln, Q)
n = 8 (1.5%)
Histidine (His, H)
n = 19 (3.56%)
Lysine (Lys, K)
n = 13 (2.44%)
Arginine (Arg, R)
n = 9 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 20 29 9 7 26 8 9 8 0 7 12 9 3 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 7 9 18 1 3 15 19 8 5 12 16 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 0 7 6 14 1 1 5 9 10 0 1 7 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 1 5 8 11 2 4 0 4 1 1 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
132 120 160 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
83 143 98 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 175 206 123
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 11 (4.85%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 9 6 4 14 2 3 7 3 4 1 9 1 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 6 10 0 2 6 1 1 2 5 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 1 3 9 0 0 1 1 7 1 0 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 14 2 7 2 3 0 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 67 53 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 67 61 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 70 104 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 37 (14.23%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 18 (6.92%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 5 (1.92%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 11 5 4 18 2 8 7 0 1 8 9 2 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 5 5 1 3 4 11 2 3 1 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 1 1 1 10 1 2 2 6 6 3 0 1 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 2 3 5 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 66 65 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 64 56 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 80 120 46
CYTB (size: 1114 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.41%)
Alanine (Ala, A)
n = 21 (5.68%)
Serine (Ser, S)
n = 30 (8.11%)
Threonine (Thr, T)
n = 37 (10.0%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 8 (2.16%)
Leucine (Leu, L)
n = 43 (11.62%)
Isoleucine (Ile, I)
n = 42 (11.35%)
Methionine (Met, M)
n = 20 (5.41%)
Proline (Pro, P)
n = 21 (5.68%)
Phenylalanine (Phe, F)
n = 36 (9.73%)
Tyrosine (Tyr, Y)
n = 14 (3.78%)
Tryptophan (Trp, W)
n = 11 (2.97%)
Aspartic acid (Asp, D)
n = 6 (1.62%)
Glutamic acid (Glu, E)
n = 7 (1.89%)
Asparagine (Asn, N)
n = 19 (5.14%)
Glutamine (Gln, Q)
n = 7 (1.89%)
Histidine (His, H)
n = 13 (3.51%)
Lysine (Lys, K)
n = 8 (2.16%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 28 18 8 10 16 0 9 6 1 2 2 4 0 15 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 14 5 0 2 10 7 1 5 5 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 1 7 7 14 0 0 2 6 8 1 0 7 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 1 5 7 1 1 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 81 128 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 107 74 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 145 137 81
ND1 (size: 961 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.33%)
Alanine (Ala, A)
n = 20 (6.27%)
Serine (Ser, S)
n = 27 (8.46%)
Threonine (Thr, T)
n = 28 (8.78%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 7 (2.19%)
Leucine (Leu, L)
n = 59 (18.5%)
Isoleucine (Ile, I)
n = 26 (8.15%)
Methionine (Met, M)
n = 23 (7.21%)
Proline (Pro, P)
n = 21 (6.58%)
Phenylalanine (Phe, F)
n = 18 (5.64%)
Tyrosine (Tyr, Y)
n = 10 (3.13%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 12 (3.76%)
Asparagine (Asn, N)
n = 15 (4.7%)
Glutamine (Gln, Q)
n = 7 (2.19%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.51%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 22 10 10 36 0 3 6 1 2 2 3 0 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 6 11 0 1 6 8 2 1 10 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 2 3 13 10 1 0 0 5 5 1 0 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 1 2 1 8 0 1 0 5 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 93 100 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 96 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 101 152 57
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 22 (6.43%)
Serine (Ser, S)
n = 26 (7.6%)
Threonine (Thr, T)
n = 65 (19.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 53 (15.5%)
Isoleucine (Ile, I)
n = 33 (9.65%)
Methionine (Met, M)
n = 34 (9.94%)
Proline (Pro, P)
n = 20 (5.85%)
Phenylalanine (Phe, F)
n = 9 (2.63%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 9 (2.63%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 15 (4.39%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 8 (2.34%)
Lysine (Lys, K)
n = 12 (3.51%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 17 32 8 6 28 4 7 4 2 2 0 2 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 7 11 1 1 4 4 1 0 9 11 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 27 2 2 8 11 2 0 3 1 4 1 0 8 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 1 10 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 84 162 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 130 53 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 98 165 63
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 22 (6.43%)
Serine (Ser, S)
n = 26 (7.6%)
Threonine (Thr, T)
n = 65 (19.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.17%)
Leucine (Leu, L)
n = 53 (15.5%)
Isoleucine (Ile, I)
n = 33 (9.65%)
Methionine (Met, M)
n = 34 (9.94%)
Proline (Pro, P)
n = 20 (5.85%)
Phenylalanine (Phe, F)
n = 9 (2.63%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 9 (2.63%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 15 (4.39%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 8 (2.34%)
Lysine (Lys, K)
n = 12 (3.51%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 17 32 8 6 28 4 7 4 2 2 0 2 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 7 11 1 1 4 4 1 0 9 11 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 27 2 2 8 11 2 0 3 1 4 1 0 8 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 1 10 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 84 162 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 130 53 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 98 165 63
ND4 (size: 1338 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.37%)
Alanine (Ala, A)
n = 31 (6.97%)
Serine (Ser, S)
n = 29 (6.52%)
Threonine (Thr, T)
n = 58 (13.03%)
Cysteine (Cys, C)
n = 4 (0.9%)
Valine (Val, V)
n = 8 (1.8%)
Leucine (Leu, L)
n = 86 (19.33%)
Isoleucine (Ile, I)
n = 40 (8.99%)
Methionine (Met, M)
n = 35 (7.87%)
Proline (Pro, P)
n = 24 (5.39%)
Phenylalanine (Phe, F)
n = 17 (3.82%)
Tyrosine (Tyr, Y)
n = 13 (2.92%)
Tryptophan (Trp, W)
n = 10 (2.25%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 10 (2.25%)
Asparagine (Asn, N)
n = 17 (3.82%)
Glutamine (Gln, Q)
n = 13 (2.92%)
Histidine (His, H)
n = 12 (2.7%)
Lysine (Lys, K)
n = 11 (2.47%)
Arginine (Arg, R)
n = 9 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 33 13 9 50 3 11 13 0 3 0 4 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 7 12 11 1 1 5 7 2 6 7 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 32 4 3 10 10 2 2 2 3 10 1 0 4 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 1 0 3 11 0 1 0 7 1 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 133 166 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 138 79 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 125 219 84
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 7 (7.29%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 6 (6.25%)
Leucine (Leu, L)
n = 20 (20.83%)
Isoleucine (Ile, I)
n = 8 (8.33%)
Methionine (Met, M)
n = 11 (11.46%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 2 (2.08%)
Glutamine (Gln, Q)
n = 3 (3.13%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 6 9 7 2 8 0 3 2 1 3 1 2 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 2 4 0 0 1 2 0 0 1 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 1 2 0 3 0 1 2 0 1 0 0 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 3 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 25 38 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 25 15 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 26 42 25
ND5 (size: 1788 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.87%)
Alanine (Ala, A)
n = 32 (5.38%)
Serine (Ser, S)
n = 48 (8.07%)
Threonine (Thr, T)
n = 73 (12.27%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 13 (2.18%)
Leucine (Leu, L)
n = 90 (15.13%)
Isoleucine (Ile, I)
n = 68 (11.43%)
Methionine (Met, M)
n = 44 (7.39%)
Proline (Pro, P)
n = 27 (4.54%)
Phenylalanine (Phe, F)
n = 32 (5.38%)
Tyrosine (Tyr, Y)
n = 13 (2.18%)
Tryptophan (Trp, W)
n = 9 (1.51%)
Aspartic acid (Asp, D)
n = 10 (1.68%)
Glutamic acid (Glu, E)
n = 14 (2.35%)
Asparagine (Asn, N)
n = 36 (6.05%)
Glutamine (Gln, Q)
n = 18 (3.03%)
Histidine (His, H)
n = 13 (2.18%)
Lysine (Lys, K)
n = 23 (3.87%)
Arginine (Arg, R)
n = 7 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 33 39 19 11 38 3 18 17 1 3 3 7 0 15 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 3 9 19 1 3 9 8 3 4 8 14 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 26 0 10 10 20 0 4 4 5 8 1 1 17 19 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 3 4 6 22 1 1 0 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 136 252 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 172 128 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 176 254 146
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.37%)
Alanine (Ala, A)
n = 5 (2.91%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 37 (21.51%)
Leucine (Leu, L)
n = 25 (14.53%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 2 (1.16%)
Phenylalanine (Phe, F)
n = 15 (8.72%)
Tyrosine (Tyr, Y)
n = 10 (5.81%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 7 (4.07%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 2 (1.16%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 3 2 1 0 1 9 0 2 16 0 11 10 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 7 0 3 0 1 1 13 0 1 9 2 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 3 2 0 0 5 0 9 1 2 12 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 3 0 1 0 1 1 0 1 1 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 12 25 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 15 24 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 5 34 88
Total protein-coding genes (size: 11301 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 197 (5.23%)
Alanine (Ala, A)
n = 224 (5.95%)
Serine (Ser, S)
n = 268 (7.12%)
Threonine (Thr, T)
n = 419 (11.13%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 165 (4.38%)
Leucine (Leu, L)
n = 585 (15.54%)
Isoleucine (Ile, I)
n = 334 (8.87%)
Methionine (Met, M)
n = 250 (6.64%)
Proline (Pro, P)
n = 204 (5.42%)
Phenylalanine (Phe, F)
n = 214 (5.69%)
Tyrosine (Tyr, Y)
n = 115 (3.06%)
Tryptophan (Trp, W)
n = 96 (2.55%)
Aspartic acid (Asp, D)
n = 57 (1.51%)
Glutamic acid (Glu, E)
n = 100 (2.66%)
Asparagine (Asn, N)
n = 148 (3.93%)
Glutamine (Gln, Q)
n = 92 (2.44%)
Histidine (His, H)
n = 98 (2.6%)
Lysine (Lys, K)
n = 103 (2.74%)
Arginine (Arg, R)
n = 60 (1.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 174 224 97 77 274 29 94 80 12 47 36 65 17 105 109
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 17 12 39 75 104 6 29 64 75 29 32 66 102 4 77
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
150 180 12 43 70 103 7 17 28 49 66 11 14 55 93 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 85 15 23 34 94 9 11 2 43 4 3 0 4 0 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
743 931 1302 789
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
430 1070 717 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
195 1121 1615 834

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.