Viewing data for Cuora amboinensis


Scientific name Cuora amboinensis
Common name Southeast Asian box turtle
Maximum lifespan 38.20 years (Cuora amboinensis@AnAge)

Total mtDNA (size: 16708 bases) GC AT G C A T
Base content (bases) 6587 10121 4405 2182 4469 5652
Base content per 1 kb (bases) 394 606 264 131 267 338
Base content (%) 39.4% 60.6%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 4613 6766 3239 1374 3022 3744
Base content per 1 kb (bases) 405 595 285 121 266 329
Base content (%) 40.5% 59.5%
D-loop (size: 1182 bases) GC AT G C A T
Base content (bases) 314 868 187 127 476 392
Base content per 1 kb (bases) 266 734 158 107 403 332
Base content (%) 26.6% 73.4%
Total tRNA-coding genes (size: 1547 bases) GC AT G C A T
Base content (bases) 596 951 351 245 410 541
Base content per 1 kb (bases) 385 615 227 158 265 350
Base content (%) 38.5% 61.5%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1053 1519 617 436 550 969
Base content per 1 kb (bases) 409 591 240 170 214 377
Base content (%) 40.9% 59.1%
12S rRNA gene (size: 966 bases) GC AT G C A T
Base content (bases) 405 561 239 166 210 351
Base content per 1 kb (bases) 419 581 247 172 217 363
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1606 bases) GC AT G C A T
Base content (bases) 648 958 378 270 340 618
Base content per 1 kb (bases) 403 597 235 168 212 385
Base content (%) 40.3% 59.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 262 422 198 64 189 233
Base content per 1 kb (bases) 383 617 289 94 276 341
Base content (%) 38.3% 61.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 59 109 44 15 45 64
Base content per 1 kb (bases) 351 649 262 89 268 381
Base content (%) 35.1% 64.9%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 657 891 390 267 459 432
Base content per 1 kb (bases) 424 576 252 172 297 279
Base content (%) 42.4% 57.6%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 260 427 167 93 189 238
Base content per 1 kb (bases) 378 622 243 135 275 346
Base content (%) 37.8% 62.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 331 453 211 120 216 237
Base content per 1 kb (bases) 422 578 269 153 276 302
Base content (%) 42.2% 57.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 501 639 364 137 301 338
Base content per 1 kb (bases) 439 561 319 120 264 296
Base content (%) 43.9% 56.1%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 395 576 283 112 272 304
Base content per 1 kb (bases) 407 593 291 115 280 313
Base content (%) 40.7% 59.3%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 409 633 311 98 253 380
Base content per 1 kb (bases) 393 607 298 94 243 365
Base content (%) 39.3% 60.7%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 130 220 92 38 107 113
Base content per 1 kb (bases) 371 629 263 109 306 323
Base content (%) 37.1% 62.9%
ND4 (size: 1392 bases) GC AT G C A T
Base content (bases) 563 829 402 161 357 472
Base content per 1 kb (bases) 404 596 289 116 256 339
Base content (%) 40.4% 59.6%
ND4L (size: 300 bases) GC AT G C A T
Base content (bases) 124 176 86 38 93 83
Base content per 1 kb (bases) 413 587 287 127 310 277
Base content (%) 41.3% 58.7%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 727 1079 536 191 468 611
Base content per 1 kb (bases) 403 597 297 106 259 338
Base content (%) 40.3% 59.7%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 198 327 156 42 79 248
Base content per 1 kb (bases) 377 623 297 80 150 472
Base content (%) 37.7% 62.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 30 (13.22%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 10 8 7 23 2 16 8 1 0 3 4 1 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 8 3 0 1 0 9 0 1 3 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 16 0 3 1 4 0 0 2 2 1 0 0 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 3 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 72 79 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 66 35 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 60 119 43
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNLDPWFLILSSTWLAYIVILQPKISSYLSMNDPANKDNKMTSTNPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 3 (5.45%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 0 1 2 0 4 2 0 0 0 1 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 0 1 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 2 2 0 1 0 1 1 1 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 2 1 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 11 21 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 16 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 15 27 11
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 32 (6.21%)
Threonine (Thr, T)
n = 36 (6.99%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.99%)
Leucine (Leu, L)
n = 60 (11.65%)
Isoleucine (Ile, I)
n = 40 (7.77%)
Methionine (Met, M)
n = 31 (6.02%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 39 (7.57%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 25 9 7 16 9 16 8 1 8 5 20 3 22 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 8 19 18 1 9 12 21 5 6 4 14 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 9 6 12 1 1 3 7 12 1 3 4 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 7 8 9 0 3 1 4 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 104 135 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 96 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 150 201 130
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 12 (5.26%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.02%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 8 (3.51%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 12 (5.26%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 15 5 1 8 4 8 7 0 2 3 11 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 2 7 0 0 0 7 1 2 1 9 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 2 4 7 0 0 3 6 3 0 0 3 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 2 4 4 5 0 1 1 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 57 67 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 56 107 54
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 4 7 3 3 11 0 14 8 0 1 3 10 1 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 9 9 0 4 6 8 2 2 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 1 1 2 9 0 1 3 3 9 1 0 0 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 3 1 2 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 58 61 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 82 122 48
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 32 (8.44%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 10 (2.64%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 24 12 9 15 24 4 11 6 2 0 3 10 0 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 9 10 8 0 4 8 13 1 3 7 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 10 0 3 6 15 0 0 1 0 14 0 0 7 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 7 9 0 0 2 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 102 108 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 106 78 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 156 152 63
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 22 (6.83%)
Serine (Ser, S)
n = 26 (8.07%)
Threonine (Thr, T)
n = 23 (7.14%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.73%)
Leucine (Leu, L)
n = 58 (18.01%)
Isoleucine (Ile, I)
n = 26 (8.07%)
Methionine (Met, M)
n = 19 (5.9%)
Proline (Pro, P)
n = 24 (7.45%)
Phenylalanine (Phe, F)
n = 22 (6.83%)
Tyrosine (Tyr, Y)
n = 13 (4.04%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 14 (4.35%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 16 7 10 26 3 11 6 1 0 1 11 0 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 9 7 6 0 2 6 7 1 3 4 15 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 3 7 14 1 1 0 2 11 0 1 3 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 3 7 1 0 1 6 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 86 91 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 94 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 103 153 53
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 30 (8.67%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 26 3 6 28 1 14 14 2 0 2 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 14 10 0 1 4 6 2 2 6 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 26 0 4 10 8 0 1 5 1 6 0 2 5 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 12 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 87 140 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 117 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 107 180 49
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 30 (8.67%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 26 3 6 28 1 14 14 2 0 2 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 14 10 0 1 4 6 2 2 6 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 26 0 4 10 8 0 1 5 1 6 0 2 5 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 12 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 87 140 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 117 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 107 180 49
ND4 (size: 1392 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (4.97%)
Alanine (Ala, A)
n = 30 (6.48%)
Serine (Ser, S)
n = 31 (6.7%)
Threonine (Thr, T)
n = 57 (12.31%)
Cysteine (Cys, C)
n = 8 (1.73%)
Valine (Val, V)
n = 9 (1.94%)
Leucine (Leu, L)
n = 87 (18.79%)
Isoleucine (Ile, I)
n = 37 (7.99%)
Methionine (Met, M)
n = 38 (8.21%)
Proline (Pro, P)
n = 24 (5.18%)
Phenylalanine (Phe, F)
n = 18 (3.89%)
Tyrosine (Tyr, Y)
n = 12 (2.59%)
Tryptophan (Trp, W)
n = 14 (3.02%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 12 (2.59%)
Asparagine (Asn, N)
n = 14 (3.02%)
Glutamine (Gln, Q)
n = 14 (3.02%)
Histidine (His, H)
n = 11 (2.38%)
Lysine (Lys, K)
n = 11 (2.38%)
Arginine (Arg, R)
n = 11 (2.38%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 34 8 11 39 9 19 14 0 0 2 7 0 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 5 9 11 10 0 2 7 9 5 2 5 16 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 25 0 2 7 13 2 2 5 5 7 0 1 4 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 0 2 11 0 1 3 7 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 127 164 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 135 77 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 231 71
ND4L (size: 300 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.05%)
Alanine (Ala, A)
n = 8 (8.08%)
Serine (Ser, S)
n = 14 (14.14%)
Threonine (Thr, T)
n = 6 (6.06%)
Cysteine (Cys, C)
n = 4 (4.04%)
Valine (Val, V)
n = 3 (3.03%)
Leucine (Leu, L)
n = 22 (22.22%)
Isoleucine (Ile, I)
n = 4 (4.04%)
Methionine (Met, M)
n = 9 (9.09%)
Proline (Pro, P)
n = 2 (2.02%)
Phenylalanine (Phe, F)
n = 6 (6.06%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.01%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.03%)
Asparagine (Asn, N)
n = 2 (2.02%)
Glutamine (Gln, Q)
n = 4 (4.04%)
Histidine (His, H)
n = 5 (5.05%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.01%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 7 3 2 12 0 4 4 0 1 0 2 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 3 4 1 0 1 1 3 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 4 6 1 0 2 0 0 1 1 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 29 23 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 28 15 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 29 45 20
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.66%)
Alanine (Ala, A)
n = 40 (6.66%)
Serine (Ser, S)
n = 50 (8.32%)
Threonine (Thr, T)
n = 66 (10.98%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.16%)
Leucine (Leu, L)
n = 91 (15.14%)
Isoleucine (Ile, I)
n = 63 (10.48%)
Methionine (Met, M)
n = 39 (6.49%)
Proline (Pro, P)
n = 31 (5.16%)
Phenylalanine (Phe, F)
n = 35 (5.82%)
Tyrosine (Tyr, Y)
n = 16 (2.66%)
Tryptophan (Trp, W)
n = 11 (1.83%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 12 (2.0%)
Asparagine (Asn, N)
n = 30 (4.99%)
Glutamine (Gln, Q)
n = 16 (2.66%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 23 (3.83%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 38 35 8 15 46 3 18 14 2 4 2 6 1 15 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 5 7 19 14 0 2 13 11 2 4 7 20 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 28 3 3 16 19 0 1 11 5 11 0 1 5 25 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 4 4 6 21 2 1 2 5 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 141 233 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 175 121 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 220 257 102
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.37%)
Alanine (Ala, A)
n = 8 (4.6%)
Serine (Ser, S)
n = 16 (9.2%)
Threonine (Thr, T)
n = 2 (1.15%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 23 (13.22%)
Leucine (Leu, L)
n = 29 (16.67%)
Isoleucine (Ile, I)
n = 9 (5.17%)
Methionine (Met, M)
n = 9 (5.17%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 2 (1.15%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 2 5 0 0 0 13 1 0 12 2 5 4 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 0 3 0 2 3 7 1 1 16 3 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 8 0 2 0 6 0 10 0 2 11 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 3 1 0 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 15 28 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 23 21 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 4 30 93
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.93%)
Alanine (Ala, A)
n = 264 (6.95%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 352 (9.27%)
Cysteine (Cys, C)
n = 33 (0.87%)
Valine (Val, V)
n = 157 (4.14%)
Leucine (Leu, L)
n = 609 (16.04%)
Isoleucine (Ile, I)
n = 314 (8.27%)
Methionine (Met, M)
n = 234 (6.16%)
Proline (Pro, P)
n = 211 (5.56%)
Phenylalanine (Phe, F)
n = 224 (5.9%)
Tyrosine (Tyr, Y)
n = 123 (3.24%)
Tryptophan (Trp, W)
n = 108 (2.85%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 103 (2.71%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
144 170 194 69 82 247 36 155 94 9 29 26 92 10 100 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 13 20 59 108 93 4 34 60 96 35 29 43 128 11 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
130 151 6 41 66 112 6 13 36 43 80 5 20 41 99 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 80 12 30 34 85 3 10 12 46 2 0 2 7 0 103
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
802 921 1179 895
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1052 720 1538
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
201 1153 1683 760

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.