Viewing data for Spalacopus cyanus


Scientific name Spalacopus cyanus
Common name Coruro
Maximum lifespan 10.80 years (Spalacopus cyanus@AnAge)

Total mtDNA (size: 16830 bases) GC AT G C A T
Base content (bases) 6219 10611 4144 2075 4801 5810
Base content per 1 kb (bases) 370 630 246 123 285 345
Base content (%) 37.0% 63.0%
Total protein-coding genes (size: 11359 bases) GC AT G C A T
Base content (bases) 4202 7157 2938 1264 3385 3772
Base content per 1 kb (bases) 370 630 259 111 298 332
Base content (%) 37.0% 63.0%
D-loop (size: 1335 bases) GC AT G C A T
Base content (bases) 519 816 351 168 332 484
Base content per 1 kb (bases) 389 611 263 126 249 363
Base content (%) 38.9% 61.1%
Total tRNA-coding genes (size: 1504 bases) GC AT G C A T
Base content (bases) 526 978 306 220 431 547
Base content per 1 kb (bases) 350 650 203 146 287 364
Base content (%) 35.0% 65.0%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 916 1609 509 407 632 977
Base content per 1 kb (bases) 363 637 202 161 250 387
Base content (%) 36.3% 63.7%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 361 593 207 154 223 370
Base content per 1 kb (bases) 378 622 217 161 234 388
Base content (%) 37.8% 62.2%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 555 1016 302 253 409 607
Base content per 1 kb (bases) 353 647 192 161 260 386
Base content (%) 35.3% 64.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 253 428 180 73 219 209
Base content per 1 kb (bases) 372 628 264 107 322 307
Base content (%) 37.2% 62.8%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 58 149 49 9 59 90
Base content per 1 kb (bases) 280 720 237 43 285 435
Base content (%) 28.0% 72.0%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 602 952 351 251 483 469
Base content per 1 kb (bases) 387 613 226 162 311 302
Base content (%) 38.7% 61.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 236 448 150 86 209 239
Base content per 1 kb (bases) 345 655 219 126 306 349
Base content (%) 34.5% 65.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 308 476 197 111 239 237
Base content per 1 kb (bases) 393 607 251 142 305 302
Base content (%) 39.3% 60.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 470 670 326 144 311 359
Base content per 1 kb (bases) 412 588 286 126 273 315
Base content (%) 41.2% 58.8%
ND1 (size: 958 bases) GC AT G C A T
Base content (bases) 363 595 264 99 282 313
Base content per 1 kb (bases) 379 621 276 103 294 327
Base content (%) 37.9% 62.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 352 690 277 75 304 386
Base content per 1 kb (bases) 338 662 266 72 292 370
Base content (%) 33.8% 66.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 127 219 89 38 112 107
Base content per 1 kb (bases) 367 633 257 110 324 309
Base content (%) 36.7% 63.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 493 885 367 126 416 469
Base content per 1 kb (bases) 358 642 266 91 302 340
Base content (%) 35.8% 64.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 105 192 68 37 107 85
Base content per 1 kb (bases) 354 646 229 125 360 286
Base content (%) 35.4% 64.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 660 1152 479 181 553 599
Base content per 1 kb (bases) 364 636 264 100 305 331
Base content (%) 36.4% 63.6%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 192 342 154 38 109 233
Base content per 1 kb (bases) 360 640 288 71 204 436
Base content (%) 36.0% 64.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 7 12 6 5 19 0 12 6 1 2 0 4 2 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 7 5 5 0 1 4 4 1 5 6 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 0 4 4 2 0 2 2 1 1 0 2 5 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 5 1 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 64 82 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 62 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 54 91 70
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWLITILSMIITLFTMFQIKTSMHSFYTNPQQLYLKTTKQKTPWEKKWTKIYSPLLSHRQY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (8.82%)
Threonine (Thr, T)
n = 11 (16.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (11.76%)
Isoleucine (Ile, I)
n = 6 (8.82%)
Methionine (Met, M)
n = 4 (5.88%)
Proline (Pro, P)
n = 4 (5.88%)
Phenylalanine (Phe, F)
n = 3 (4.41%)
Tyrosine (Tyr, Y)
n = 4 (5.88%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 1 (1.47%)
Asparagine (Asn, N)
n = 1 (1.47%)
Glutamine (Gln, Q)
n = 6 (8.82%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 7 (10.29%)
Arginine (Arg, R)
n = 1 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 3 1 1 3 0 3 6 0 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 2 0 4 0 0 0 3 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 1 0 6 1 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 18 29 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 23 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 10 38 18
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 38 (7.35%)
Serine (Ser, S)
n = 31 (6.0%)
Threonine (Thr, T)
n = 41 (7.93%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.16%)
Leucine (Leu, L)
n = 59 (11.41%)
Isoleucine (Ile, I)
n = 39 (7.54%)
Methionine (Met, M)
n = 30 (5.8%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 44 (8.51%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 18 (3.48%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 11 27 5 2 18 4 27 6 1 4 10 20 3 21 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 16 6 16 0 6 9 26 6 12 7 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 25 1 7 4 17 0 0 3 8 11 2 3 10 7 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 0 3 11 9 0 0 0 7 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 91 140 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 124 234 134
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 18 (7.93%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 5 (2.2%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 14 5 1 11 0 13 5 0 5 1 2 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 6 0 1 0 2 2 4 0 5 0 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 1 2 4 10 0 2 2 5 6 1 2 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 15 1 5 5 5 0 1 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 46 74 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 49 105 64
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 10 8 2 13 1 8 8 0 2 1 11 1 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 5 6 1 2 6 11 1 4 4 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 7 1 10 0 0 4 4 9 0 1 3 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 1 2 1 3 0 2 0 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 63 63 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 66 57 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 68 117 68
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 16 6 6 28 2 14 5 1 3 6 8 0 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 5 6 10 0 4 3 12 5 6 7 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 1 3 3 16 0 0 3 4 10 1 0 3 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 1 2 9 10 0 1 3 4 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 92 116 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 95 77 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 139 166 61
ND1 (size: 958 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (3.14%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 23 (7.23%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 8 (2.52%)
Leucine (Leu, L)
n = 56 (17.61%)
Isoleucine (Ile, I)
n = 28 (8.81%)
Methionine (Met, M)
n = 26 (8.18%)
Proline (Pro, P)
n = 23 (7.23%)
Phenylalanine (Phe, F)
n = 18 (5.66%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.14%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.57%)
Lysine (Lys, K)
n = 9 (2.83%)
Arginine (Arg, R)
n = 7 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 24 5 4 32 1 12 5 1 3 1 4 0 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 7 13 8 0 1 3 6 0 8 4 10 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 2 7 4 10 0 0 2 5 5 0 2 4 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 1 1 2 9 0 0 1 6 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 83 103 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 97 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 84 154 71
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 12 (3.47%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 42 (12.14%)
Methionine (Met, M)
n = 29 (8.38%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 25 (7.23%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 19 27 5 9 26 5 15 9 0 1 2 4 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 3 6 0 0 4 10 0 6 6 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 24 1 7 8 14 0 0 1 5 6 1 1 12 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 0 11 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 81 152 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 67 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 94 167 76
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 12 (3.47%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 42 (12.14%)
Methionine (Met, M)
n = 29 (8.38%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 25 (7.23%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 19 27 5 9 26 5 15 9 0 1 2 4 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 3 6 0 0 4 10 0 6 6 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 24 1 7 8 14 0 0 1 5 6 1 1 12 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 0 11 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 81 152 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 67 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 94 167 76
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 19 (4.15%)
Serine (Ser, S)
n = 44 (9.61%)
Threonine (Thr, T)
n = 43 (9.39%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 47 (10.26%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 19 (4.15%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 21 27 18 11 34 3 29 10 0 3 1 7 0 5 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 4 10 0 1 4 12 1 6 8 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 27 1 9 11 13 0 1 10 4 15 2 0 10 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 0 2 3 12 0 1 1 8 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 120 164 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 118 89 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 129 216 105
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 16 (16.33%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 8 2 1 6 0 7 2 0 2 1 4 1 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 3 1 1 2 2 1 0 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 6 1 2 0 0 0 1 3 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 16 30 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 29 38 27
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (3.98%)
Alanine (Ala, A)
n = 40 (6.63%)
Serine (Ser, S)
n = 55 (9.12%)
Threonine (Thr, T)
n = 54 (8.96%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 15 (2.49%)
Leucine (Leu, L)
n = 92 (15.26%)
Isoleucine (Ile, I)
n = 51 (8.46%)
Methionine (Met, M)
n = 40 (6.63%)
Proline (Pro, P)
n = 25 (4.15%)
Phenylalanine (Phe, F)
n = 43 (7.13%)
Tyrosine (Tyr, Y)
n = 21 (3.48%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 12 (1.99%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 44 (7.3%)
Glutamine (Gln, Q)
n = 20 (3.32%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 19 (3.15%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 23 36 15 15 30 2 29 19 1 0 4 11 0 16 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 5 1 10 13 17 0 2 9 11 2 9 8 7 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 26 1 13 16 14 2 4 6 9 12 2 1 20 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 1 4 8 18 1 1 2 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 127 218 158
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 164 138 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 188 243 154
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 10 (5.65%)
Serine (Ser, S)
n = 13 (7.34%)
Threonine (Thr, T)
n = 5 (2.82%)
Cysteine (Cys, C)
n = 4 (2.26%)
Valine (Val, V)
n = 23 (12.99%)
Leucine (Leu, L)
n = 21 (11.86%)
Isoleucine (Ile, I)
n = 16 (9.04%)
Methionine (Met, M)
n = 8 (4.52%)
Proline (Pro, P)
n = 3 (1.69%)
Phenylalanine (Phe, F)
n = 12 (6.78%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 7 (3.95%)
Aspartic acid (Asp, D)
n = 3 (1.69%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 4 (2.26%)
Glutamine (Gln, Q)
n = 2 (1.13%)
Histidine (His, H)
n = 1 (0.56%)
Lysine (Lys, K)
n = 2 (1.13%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 4 4 0 1 0 10 1 1 13 1 4 5 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 6 1 1 2 11 0 1 13 3 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 3 0 0 3 7 0 10 0 1 6 4 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 3 0 0 2 0 0 0 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 11 42 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 24 31 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 3 36 97
Total protein-coding genes (size: 11417 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.5%)
Alanine (Ala, A)
n = 221 (5.81%)
Serine (Ser, S)
n = 299 (7.86%)
Threonine (Thr, T)
n = 331 (8.7%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 158 (4.15%)
Leucine (Leu, L)
n = 595 (15.65%)
Isoleucine (Ile, I)
n = 355 (9.33%)
Methionine (Met, M)
n = 243 (6.39%)
Proline (Pro, P)
n = 194 (5.1%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 142 (3.73%)
Tryptophan (Trp, W)
n = 107 (2.81%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 175 (4.6%)
Glutamine (Gln, Q)
n = 91 (2.39%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 96 (2.52%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
206 149 212 86 60 228 18 185 85 6 38 28 79 13 95 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 18 12 73 61 83 4 33 46 99 31 69 55 64 6 68
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
75 177 11 71 58 114 5 17 34 60 82 10 18 79 96 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 84 10 24 42 90 6 6 9 47 2 1 1 5 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
748 839 1253 964
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 994 768 1579
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
173 1002 1650 979

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.