Viewing data for Sillago sihama


Scientific name Sillago sihama
Common name Northern whiting
Maximum lifespan 7.00 years (Sillago sihama@AnAge)

Total mtDNA (size: 16599 bases) GC AT G C A T
Base content (bases) 7911 8688 4914 2997 4332 4356
Base content per 1 kb (bases) 477 523 296 181 261 262
Base content (%) 47.7% 52.3%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5492 5920 3588 1904 3130 2790
Base content per 1 kb (bases) 481 519 314 167 274 244
Base content (%) 48.1% 51.9%
D-loop (size: 910 bases) GC AT G C A T
Base content (bases) 356 554 211 145 254 300
Base content per 1 kb (bases) 391 609 232 159 279 330
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1560 bases) GC AT G C A T
Base content (bases) 726 834 390 336 376 458
Base content per 1 kb (bases) 465 535 250 215 241 294
Base content (%) 46.5% 53.5%
Total rRNA-coding genes (size: 2676 bases) GC AT G C A T
Base content (bases) 1320 1356 708 612 561 795
Base content per 1 kb (bases) 493 507 265 229 210 297
Base content (%) 49.3% 50.7%
12S rRNA gene (size: 958 bases) GC AT G C A T
Base content (bases) 487 471 260 227 192 279
Base content per 1 kb (bases) 508 492 271 237 200 291
Base content (%) 50.8% 49.2%
16S rRNA gene (size: 1718 bases) GC AT G C A T
Base content (bases) 833 885 448 385 369 516
Base content per 1 kb (bases) 485 515 261 224 215 300
Base content (%) 48.5% 51.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 321 363 208 113 208 155
Base content per 1 kb (bases) 469 531 304 165 304 227
Base content (%) 46.9% 53.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 55 21 51 41
Base content per 1 kb (bases) 452 548 327 125 304 244
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 743 808 444 299 440 368
Base content per 1 kb (bases) 479 521 286 193 284 237
Base content (%) 47.9% 52.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 319 372 194 125 190 182
Base content per 1 kb (bases) 462 538 281 181 275 263
Base content (%) 46.2% 53.8%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 386 400 251 135 215 185
Base content per 1 kb (bases) 491 509 319 172 274 235
Base content (%) 49.1% 50.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 538 605 358 180 329 276
Base content per 1 kb (bases) 471 529 313 157 288 241
Base content (%) 47.1% 52.9%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 463 512 311 152 285 227
Base content per 1 kb (bases) 475 525 319 156 292 233
Base content (%) 47.5% 52.5%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 549 497 374 175 267 230
Base content per 1 kb (bases) 525 475 358 167 255 220
Base content (%) 52.5% 47.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 172 177 109 63 112 65
Base content per 1 kb (bases) 493 507 312 181 321 186
Base content (%) 49.3% 50.7%
ND4 (size: 1383 bases) GC AT G C A T
Base content (bases) 658 725 433 225 375 350
Base content per 1 kb (bases) 476 524 313 163 271 253
Base content (%) 47.6% 52.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 153 144 100 53 85 59
Base content per 1 kb (bases) 515 485 337 178 286 199
Base content (%) 51.5% 48.5%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 868 971 583 285 499 472
Base content per 1 kb (bases) 472 528 317 155 271 257
Base content (%) 47.2% 52.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 253 269 171 82 80 189
Base content per 1 kb (bases) 485 515 328 157 153 362
Base content (%) 48.5% 51.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (8.37%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 7 9 9 8 11 14 7 1 4 7 5 3 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 12 3 0 0 6 1 3 3 7 3 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 5 1 2 3 2 2 2 1 2 0 3 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 0 1 1 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 69 58 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 29 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 77 68 48
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDPAPWFAIFIFSWIVFLIFLPPKVMAHSFPNDPTAQEQKKTKTPALTWPWP*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 6 (10.91%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.27%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 1 3 0 0 0 1 2 1 0 1 1 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 2 0 0 0 0 0 0 4 3 1 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 0 2 0 0 0 0 0 0 0 2 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 1 1 4 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 17 15 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 17 13 19
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.1%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 7 (1.36%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 8 12 15 15 10 6 5 3 12 14 12 5 11 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 0 1 11 18 18 2 8 11 21 6 14 7 7 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 5 3 11 9 2 0 4 6 12 2 2 3 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 5 5 11 8 1 3 1 3 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 116 126 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 140 95 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 188 147 122
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 22 (9.61%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 16 (6.99%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 9 8 6 4 5 3 6 2 8 6 4 4 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 7 6 0 2 1 3 2 4 6 2 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 2 7 3 3 1 0 4 3 6 1 1 4 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 3 2 10 3 0 1 2 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 62 51 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 64 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 77 67 61
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 18 (6.9%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 15 (5.75%)
Phenylalanine (Phe, F)
n = 22 (8.43%)
Tyrosine (Tyr, Y)
n = 13 (4.98%)
Tryptophan (Trp, W)
n = 13 (4.98%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 14 (5.36%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 3 7 13 8 2 2 8 0 6 8 4 0 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 10 7 1 0 12 7 1 2 9 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 2 3 6 0 1 2 7 6 3 1 0 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 1 4 2 0 0 2 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 72 50 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 113 79 53
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.11%)
Alanine (Ala, A)
n = 31 (8.16%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 30 (7.89%)
Leucine (Leu, L)
n = 59 (15.53%)
Isoleucine (Ile, I)
n = 27 (7.11%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 21 (5.53%)
Phenylalanine (Phe, F)
n = 32 (8.42%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 11 3 16 17 17 3 5 6 0 5 19 5 1 8 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 1 5 12 14 0 4 9 10 4 4 8 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 2 4 7 9 1 0 1 3 11 3 1 3 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 0 5 6 7 2 0 1 6 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 100 87 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 162 113 82
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 20 (6.17%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 23 (7.1%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 8 (2.47%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 10 (3.09%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 12 3 16 18 11 5 6 6 1 6 7 8 2 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 9 17 7 1 3 8 5 2 3 12 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 5 0 7 5 3 2 1 3 6 4 0 4 7 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 0 1 2 6 1 0 0 8 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 94 75 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 122 96 83
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 32 (9.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 81 (23.34%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 9 3 21 25 15 13 7 10 5 1 5 4 1 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 5 23 11 3 3 4 4 7 10 6 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 8 2 0 10 7 7 0 3 1 6 4 0 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 3 1 2 5 4 0 3 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 121 86 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 120 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 133 89 66
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 32 (9.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 81 (23.34%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 9 3 21 25 15 13 7 10 5 1 5 4 1 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 5 23 11 3 3 4 4 7 10 6 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 8 2 0 10 7 7 0 3 1 6 4 0 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 3 1 2 5 4 0 3 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 121 86 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 120 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 133 89 66
ND4 (size: 1383 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.43%)
Alanine (Ala, A)
n = 37 (8.04%)
Serine (Ser, S)
n = 30 (6.52%)
Threonine (Thr, T)
n = 44 (9.57%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 100 (21.74%)
Isoleucine (Ile, I)
n = 29 (6.3%)
Methionine (Met, M)
n = 27 (5.87%)
Proline (Pro, P)
n = 27 (5.87%)
Phenylalanine (Phe, F)
n = 16 (3.48%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 19 (4.13%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 11 (2.39%)
Glutamine (Gln, Q)
n = 13 (2.83%)
Histidine (His, H)
n = 10 (2.17%)
Lysine (Lys, K)
n = 11 (2.39%)
Arginine (Arg, R)
n = 11 (2.39%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 11 15 26 28 15 15 11 11 2 4 5 5 3 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 2 2 5 13 17 2 2 9 10 4 6 14 6 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 9 4 3 10 7 1 2 7 4 8 4 5 5 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 4 1 4 9 2 1 3 5 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 145 131 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 129 75 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 159 144 97
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 0 (0%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 0 2 3 6 6 4 5 2 0 1 1 0 1 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 5 2 3 2 2 0 1 1 1 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 4 1 1 0 3 0 0 0 1 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 30 19 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 32 13 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 38 27 21
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 60 (9.8%)
Serine (Ser, S)
n = 48 (7.84%)
Threonine (Thr, T)
n = 52 (8.5%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.74%)
Leucine (Leu, L)
n = 90 (14.71%)
Isoleucine (Ile, I)
n = 54 (8.82%)
Methionine (Met, M)
n = 26 (4.25%)
Proline (Pro, P)
n = 32 (5.23%)
Phenylalanine (Phe, F)
n = 45 (7.35%)
Tyrosine (Tyr, Y)
n = 10 (1.63%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 10 (1.63%)
Glutamic acid (Glu, E)
n = 13 (2.12%)
Asparagine (Asn, N)
n = 26 (4.25%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 15 (2.45%)
Lysine (Lys, K)
n = 23 (3.76%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 28 14 21 24 19 10 11 12 7 6 12 8 3 16 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 2 4 14 27 17 2 1 15 10 4 8 17 3 4 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 14 3 5 15 10 4 3 11 0 10 1 5 7 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 4 3 7 14 9 1 3 5 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 150 195 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 178 117 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 255 160 129
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 20 (11.56%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 27 (15.61%)
Leucine (Leu, L)
n = 29 (16.76%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 7 (4.05%)
Phenylalanine (Phe, F)
n = 6 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 7 (4.05%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 5 0 5 5 8 0 0 9 2 5 11 6 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 11 2 4 3 7 0 7 8 5 0 1 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 1 5 0 1 3 3 0 5 4 3 6 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 4 2 0 0 0 2 0 0 3 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 29 20 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 41 22 73
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 12 38 69
Total protein-coding genes (size: 11434 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 236 (6.2%)
Alanine (Ala, A)
n = 355 (9.32%)
Serine (Ser, S)
n = 252 (6.62%)
Threonine (Thr, T)
n = 281 (7.38%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 251 (6.59%)
Leucine (Leu, L)
n = 650 (17.06%)
Isoleucine (Ile, I)
n = 257 (6.75%)
Methionine (Met, M)
n = 151 (3.96%)
Proline (Pro, P)
n = 228 (5.99%)
Phenylalanine (Phe, F)
n = 239 (6.27%)
Tyrosine (Tyr, Y)
n = 107 (2.81%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 112 (2.94%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
138 119 69 154 170 126 88 83 78 22 62 92 63 34 87 152
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
82 10 16 79 153 106 17 34 78 80 44 66 92 52 18 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
116 76 24 43 73 59 25 12 40 38 69 25 29 36 76 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
77 74 29 22 53 59 20 9 18 40 9 0 0 9 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1020 1044 932 814
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
510 1064 688 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
467 1394 1069 880

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.