Viewing data for Archilochus colubris


Scientific name Archilochus colubris
Common name Ruby-throated hummingbird
Maximum lifespan 9.10 years (Archilochus colubris@AnAge)

Total mtDNA (size: 16356 bases) GC AT G C A T
Base content (bases) 7440 8912 5114 2326 3903 5009
Base content per 1 kb (bases) 455 545 313 142 239 306
Base content (%) 45.5% 54.5%
Total protein-coding genes (size: 11374 bases) GC AT G C A T
Base content (bases) 5243 6131 3794 1449 2745 3386
Base content per 1 kb (bases) 461 539 334 127 241 298
Base content (%) 46.1% 53.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1549 bases) GC AT G C A T
Base content (bases) 656 890 396 260 379 511
Base content per 1 kb (bases) 423 575 256 168 245 330
Base content (%) 42.3% 57.5%
Total rRNA-coding genes (size: 2553 bases) GC AT G C A T
Base content (bases) 1169 1384 676 493 532 852
Base content per 1 kb (bases) 458 542 265 193 208 334
Base content (%) 45.8% 54.2%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 460 510 269 191 189 321
Base content per 1 kb (bases) 474 526 277 197 195 331
Base content (%) 47.4% 52.6%
16S rRNA gene: No data available for this section.

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 238 71 176 199
Base content per 1 kb (bases) 452 548 348 104 257 291
Base content (%) 45.2% 54.8%
ATP8 (size: 171 bases) GC AT G C A T
Base content (bases) 65 106 56 9 41 65
Base content per 1 kb (bases) 380 620 327 53 240 380
Base content (%) 38.0% 62.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 722 829 463 259 407 422
Base content per 1 kb (bases) 466 534 299 167 262 272
Base content (%) 46.6% 53.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 308 376 204 104 163 213
Base content per 1 kb (bases) 450 550 298 152 238 311
Base content (%) 45.0% 55.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 394 390 269 125 180 210
Base content per 1 kb (bases) 503 497 343 159 230 268
Base content (%) 50.3% 49.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 522 621 378 144 293 328
Base content per 1 kb (bases) 457 543 331 126 256 287
Base content (%) 45.7% 54.3%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 457 521 322 135 267 254
Base content per 1 kb (bases) 467 533 329 138 273 260
Base content (%) 46.7% 53.3%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 467 573 359 108 251 322
Base content per 1 kb (bases) 449 551 345 104 241 310
Base content (%) 44.9% 55.1%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 156 196 113 43 99 97
Base content per 1 kb (bases) 443 557 321 122 281 276
Base content (%) 44.3% 55.7%
ND4 (size: 1371 bases) GC AT G C A T
Base content (bases) 652 719 504 148 312 407
Base content per 1 kb (bases) 476 524 368 108 228 297
Base content (%) 47.6% 52.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 102 40 70 85
Base content per 1 kb (bases) 478 522 343 135 236 286
Base content (%) 47.8% 52.2%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 811 1004 605 206 420 584
Base content per 1 kb (bases) 447 553 333 113 231 322
Base content (%) 44.7% 55.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 243 279 184 59 70 209
Base content per 1 kb (bases) 466 534 352 113 134 400
Base content (%) 46.6% 53.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 16 7 6 12 30 4 4 8 0 2 0 7 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 10 3 0 1 3 3 1 4 4 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 1 6 6 0 0 4 2 3 1 0 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 3 1 0 2 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 85 66 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 35 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 88 98 32
ATP8 (size: 171 bases)
Amino acid sequence: MPQLNPNPWLFIMILSWLTFSLIIQPKLLSFTPTNTPSEKASMNNTKTLSWPWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.79%)
Serine (Ser, S)
n = 6 (10.71%)
Threonine (Thr, T)
n = 7 (12.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.29%)
Isoleucine (Ile, I)
n = 4 (7.14%)
Methionine (Met, M)
n = 3 (5.36%)
Proline (Pro, P)
n = 8 (14.29%)
Phenylalanine (Phe, F)
n = 3 (5.36%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (8.93%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.79%)
Asparagine (Asn, N)
n = 5 (8.93%)
Glutamine (Gln, Q)
n = 2 (3.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.36%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 0 1 6 0 1 2 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 3 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 1 0 0 6 0 0 0 0 0 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 22 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 12 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 17 31 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 23 19 6 14 28 6 10 6 3 5 8 18 4 10 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 12 20 14 0 4 17 24 2 4 10 16 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 2 6 8 10 1 0 3 4 13 3 0 5 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 1 14 8 1 1 0 7 0 0 1 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 121 131 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 201 197 90
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 16 8 5 6 12 3 5 7 0 3 4 8 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 6 3 0 1 1 3 3 0 1 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 0 2 6 9 0 0 4 2 6 0 1 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 4 3 9 4 0 0 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 61 55 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 59 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 84 98 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 12 7 5 8 17 1 3 8 2 0 6 8 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 10 9 1 0 8 9 4 1 6 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 1 10 4 0 0 4 2 6 1 1 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 5 2 1 4 3 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 75 53 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 124 102 21
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 21 (5.53%)
Threonine (Thr, T)
n = 32 (8.42%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 12 (3.16%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 21 9 7 15 30 1 10 8 0 4 5 7 0 2 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 6 13 7 0 5 7 11 1 3 9 10 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 14 1 1 9 9 0 0 2 5 9 1 1 5 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 1 7 9 1 0 2 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 106 103 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 102 79 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 170 146 51
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 23 (7.08%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 14 (4.31%)
Proline (Pro, P)
n = 22 (6.77%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 11 8 20 21 3 7 4 2 4 4 5 2 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 15 10 0 0 5 7 1 5 6 9 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 6 0 5 10 8 0 0 4 4 11 1 4 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 0 4 5 2 1 3 4 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 90 84 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 99 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 133 113 56
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 28 (8.12%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 19 18 9 14 23 7 11 9 0 0 4 3 1 1 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 14 6 1 0 3 6 3 2 10 9 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 1 16 10 2 1 5 2 6 3 0 3 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 12 2 0 0 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 97 121 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 141 43
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 28 (8.12%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 19 18 9 14 23 7 11 9 0 0 4 3 1 1 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 14 6 1 0 3 6 3 2 10 9 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 1 16 10 2 1 5 2 6 3 0 3 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 12 2 0 0 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 97 121 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 141 43
ND4 (size: 1371 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.73%)
Alanine (Ala, A)
n = 34 (7.46%)
Serine (Ser, S)
n = 36 (7.89%)
Threonine (Thr, T)
n = 48 (10.53%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 99 (21.71%)
Isoleucine (Ile, I)
n = 40 (8.77%)
Methionine (Met, M)
n = 23 (5.04%)
Proline (Pro, P)
n = 30 (6.58%)
Phenylalanine (Phe, F)
n = 15 (3.29%)
Tyrosine (Tyr, Y)
n = 13 (2.85%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 16 (3.51%)
Glutamine (Gln, Q)
n = 15 (3.29%)
Histidine (His, H)
n = 15 (3.29%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 35 20 12 26 49 4 8 13 2 1 4 2 1 1 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 21 8 1 2 7 5 3 2 14 14 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 18 1 2 10 14 1 2 7 2 11 5 0 2 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 1 1 9 0 0 3 7 1 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 162 146 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 139 79 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 203 182 48
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 6 3 3 13 2 1 1 0 1 1 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 3 6 1 0 3 1 0 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 2 5 3 0 1 2 0 2 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 32 25 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 40 43 9
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.13%)
Alanine (Ala, A)
n = 48 (7.95%)
Serine (Ser, S)
n = 52 (8.61%)
Threonine (Thr, T)
n = 71 (11.75%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 106 (17.55%)
Isoleucine (Ile, I)
n = 50 (8.28%)
Methionine (Met, M)
n = 31 (5.13%)
Proline (Pro, P)
n = 28 (4.64%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 29 (4.8%)
Glutamine (Gln, Q)
n = 16 (2.65%)
Histidine (His, H)
n = 14 (2.32%)
Lysine (Lys, K)
n = 22 (3.64%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 32 29 9 19 63 5 7 14 2 0 7 6 0 7 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 6 5 27 15 1 1 12 18 0 2 11 14 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 26 2 7 15 17 3 2 8 3 12 2 3 4 25 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 3 0 10 22 0 0 3 4 1 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
113 162 213 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 189 118 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 254 253 72
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 30 (17.34%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 16 (9.25%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 3 0 3 5 10 0 0 15 2 2 11 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 2 0 4 5 5 1 6 16 2 0 1 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 6 2 2 0 0 1 5 2 4 7 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 4 0 0 1 2 0 0 3 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 21 17 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 30 18 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 8 35 66
Total protein-coding genes (size: 11391 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 295 (7.77%)
Serine (Ser, S)
n = 292 (7.69%)
Threonine (Thr, T)
n = 344 (9.06%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 668 (17.6%)
Isoleucine (Ile, I)
n = 275 (7.25%)
Methionine (Met, M)
n = 175 (4.61%)
Proline (Pro, P)
n = 222 (5.85%)
Phenylalanine (Phe, F)
n = 227 (5.98%)
Tyrosine (Tyr, Y)
n = 114 (3.0%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 131 (3.45%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 108 (2.85%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
78 197 140 78 146 302 43 81 84 11 35 46 67 19 57 170
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
35 6 23 54 144 87 10 19 68 95 36 29 76 105 12 58
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
145 132 9 35 98 102 7 6 44 32 82 21 18 25 106 18
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
90 74 19 12 54 79 8 4 16 43 7 1 2 7 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
839 1064 1065 828
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
479 1103 702 1512
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
258 1505 1487 546

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.