Viewing data for Caenorhabditis elegans


Scientific name Caenorhabditis elegans
Common name Roundworm
Maximum lifespan 0.16 years (Caenorhabditis elegans@AnAge)

Total mtDNA (size: 13794 bases) GC AT G C A T
Base content (bases) 3280 10514 1225 2055 6179 4335
Base content per 1 kb (bases) 238 762 89 149 448 314
Base content (%) 23.8% 76.2%
Total protein-coding genes (size: 10293 bases) GC AT G C A T
Base content (bases) 2524 7769 950 1574 4729 3040
Base content per 1 kb (bases) 245 755 92 153 459 295
Base content (%) 24.5% 75.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1239 bases) GC AT G C A T
Base content (bases) 320 919 111 209 484 435
Base content per 1 kb (bases) 258 742 90 169 391 351
Base content (%) 25.8% 74.2%
Total rRNA-coding genes (size: 1650 bases) GC AT G C A T
Base content (bases) 383 1267 140 243 669 598
Base content per 1 kb (bases) 232 768 85 147 405 362
Base content (%) 23.2% 76.8%
12S rRNA gene (size: 697 bases) GC AT G C A T
Base content (bases) 183 514 68 115 264 250
Base content per 1 kb (bases) 263 737 98 165 379 359
Base content (%) 26.3% 73.7%
16S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 200 753 72 128 405 348
Base content per 1 kb (bases) 210 790 76 134 425 365
Base content (%) 21.0% 79.0%

ATP6 (size: 600 bases) GC AT G C A T
Base content (bases) 144 456 59 85 276 180
Base content per 1 kb (bases) 240 760 98 142 460 300
Base content (%) 24.0% 76.0%
ATP8: No data available for this section.
COX1 (size: 1578 bases) GC AT G C A T
Base content (bases) 468 1110 180 288 668 442
Base content per 1 kb (bases) 297 703 114 183 423 280
Base content (%) 29.7% 70.3%
COX2 (size: 696 bases) GC AT G C A T
Base content (bases) 180 516 61 119 298 218
Base content per 1 kb (bases) 259 741 88 171 428 313
Base content (%) 25.9% 74.1%
COX3 (size: 768 bases) GC AT G C A T
Base content (bases) 215 553 81 134 341 212
Base content per 1 kb (bases) 280 720 105 174 444 276
Base content (%) 28.0% 72.0%
CYTB (size: 1113 bases) GC AT G C A T
Base content (bases) 292 821 107 185 490 331
Base content per 1 kb (bases) 262 738 96 166 440 297
Base content (%) 26.2% 73.8%
ND1 (size: 876 bases) GC AT G C A T
Base content (bases) 221 655 92 129 402 253
Base content per 1 kb (bases) 252 748 105 147 459 289
Base content (%) 25.2% 74.8%
ND2 (size: 849 bases) GC AT G C A T
Base content (bases) 168 681 69 99 415 266
Base content per 1 kb (bases) 198 802 81 117 489 313
Base content (%) 19.8% 80.2%
ND3 (size: 336 bases) GC AT G C A T
Base content (bases) 72 264 16 56 160 104
Base content per 1 kb (bases) 214 786 48 167 476 310
Base content (%) 21.4% 78.6%
ND4 (size: 1230 bases) GC AT G C A T
Base content (bases) 274 956 115 159 589 367
Base content per 1 kb (bases) 223 777 93 129 479 298
Base content (%) 22.3% 77.7%
ND4L (size: 234 bases) GC AT G C A T
Base content (bases) 43 191 9 34 126 65
Base content per 1 kb (bases) 184 816 38 145 538 278
Base content (%) 18.4% 81.6%
ND5 (size: 1584 bases) GC AT G C A T
Base content (bases) 360 1224 132 228 738 486
Base content per 1 kb (bases) 227 773 83 144 466 307
Base content (%) 22.7% 77.3%
ND6 (size: 435 bases) GC AT G C A T
Base content (bases) 87 348 29 58 228 120
Base content per 1 kb (bases) 200 800 67 133 524 276
Base content (%) 20.0% 80.0%

ATP6 (size: 600 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (4.02%)
Alanine (Ala, A)
n = 5 (2.51%)
Serine (Ser, S)
n = 20 (10.05%)
Threonine (Thr, T)
n = 14 (7.04%)
Cysteine (Cys, C)
n = 5 (2.51%)
Valine (Val, V)
n = 18 (9.05%)
Leucine (Leu, L)
n = 30 (15.08%)
Isoleucine (Ile, I)
n = 15 (7.54%)
Methionine (Met, M)
n = 10 (5.03%)
Proline (Pro, P)
n = 4 (2.01%)
Phenylalanine (Phe, F)
n = 24 (12.06%)
Tyrosine (Tyr, Y)
n = 12 (6.03%)
Tryptophan (Trp, W)
n = 2 (1.01%)
Aspartic acid (Asp, D)
n = 3 (1.51%)
Glutamic acid (Glu, E)
n = 8 (4.02%)
Asparagine (Asn, N)
n = 6 (3.02%)
Glutamine (Gln, Q)
n = 5 (2.51%)
Histidine (His, H)
n = 1 (0.5%)
Lysine (Lys, K)
n = 6 (3.02%)
Arginine (Arg, R)
n = 3 (1.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 1 7 6 0 1 0 20 4 1 12 0 4 2 21 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 0 3 1 0 1 3 0 5 0 1 0 3 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 4 0 4 0 3 0 11 1 0 3 6 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 1 1 2 6 0 3 0 0 0 7 2 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 20 63 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 31 42 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 8 75 104
ATP8: No data available for this section.
COX1 (size: 1578 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.76%)
Alanine (Ala, A)
n = 25 (4.76%)
Serine (Ser, S)
n = 52 (9.9%)
Threonine (Thr, T)
n = 33 (6.29%)
Cysteine (Cys, C)
n = 5 (0.95%)
Valine (Val, V)
n = 41 (7.81%)
Leucine (Leu, L)
n = 78 (14.86%)
Isoleucine (Ile, I)
n = 36 (6.86%)
Methionine (Met, M)
n = 22 (4.19%)
Proline (Pro, P)
n = 20 (3.81%)
Phenylalanine (Phe, F)
n = 46 (8.76%)
Tyrosine (Tyr, Y)
n = 27 (5.14%)
Tryptophan (Trp, W)
n = 13 (2.48%)
Aspartic acid (Asp, D)
n = 15 (2.86%)
Glutamic acid (Glu, E)
n = 8 (1.52%)
Asparagine (Asn, N)
n = 19 (3.62%)
Glutamine (Gln, Q)
n = 5 (0.95%)
Histidine (His, H)
n = 15 (2.86%)
Lysine (Lys, K)
n = 12 (2.29%)
Arginine (Arg, R)
n = 7 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 3 12 9 0 5 1 50 3 2 16 2 19 4 41 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 5 0 14 1 10 0 25 0 12 9 9 0 9 2 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 14 1 15 0 5 2 7 0 25 2 1 13 18 1 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 4 15 0 12 0 7 0 0 0 21 2 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 62 152 177
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
101 100 102 223
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 18 188 268
COX2 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (6.06%)
Alanine (Ala, A)
n = 7 (3.03%)
Serine (Ser, S)
n = 24 (10.39%)
Threonine (Thr, T)
n = 10 (4.33%)
Cysteine (Cys, C)
n = 8 (3.46%)
Valine (Val, V)
n = 13 (5.63%)
Leucine (Leu, L)
n = 33 (14.29%)
Isoleucine (Ile, I)
n = 14 (6.06%)
Methionine (Met, M)
n = 9 (3.9%)
Proline (Pro, P)
n = 7 (3.03%)
Phenylalanine (Phe, F)
n = 21 (9.09%)
Tyrosine (Tyr, Y)
n = 14 (6.06%)
Tryptophan (Trp, W)
n = 5 (2.16%)
Aspartic acid (Asp, D)
n = 10 (4.33%)
Glutamic acid (Glu, E)
n = 9 (3.9%)
Asparagine (Asn, N)
n = 11 (4.76%)
Glutamine (Gln, Q)
n = 7 (3.03%)
Histidine (His, H)
n = 5 (2.16%)
Lysine (Lys, K)
n = 7 (3.03%)
Arginine (Arg, R)
n = 3 (1.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 9 2 0 2 0 24 4 3 9 0 2 2 21 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 8 0 5 0 2 0 5 0 8 1 4 0 3 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 0 4 0 3 0 7 0 12 2 1 5 10 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 6 3 9 1 6 1 3 0 0 0 7 3 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 26 68 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 31 64 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 4 86 123
COX3 (size: 768 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.45%)
Alanine (Ala, A)
n = 14 (5.49%)
Serine (Ser, S)
n = 22 (8.63%)
Threonine (Thr, T)
n = 10 (3.92%)
Cysteine (Cys, C)
n = 4 (1.57%)
Valine (Val, V)
n = 18 (7.06%)
Leucine (Leu, L)
n = 36 (14.12%)
Isoleucine (Ile, I)
n = 14 (5.49%)
Methionine (Met, M)
n = 10 (3.92%)
Proline (Pro, P)
n = 4 (1.57%)
Phenylalanine (Phe, F)
n = 41 (16.08%)
Tyrosine (Tyr, Y)
n = 11 (4.31%)
Tryptophan (Trp, W)
n = 8 (3.14%)
Aspartic acid (Asp, D)
n = 5 (1.96%)
Glutamic acid (Glu, E)
n = 8 (3.14%)
Asparagine (Asn, N)
n = 11 (4.31%)
Glutamine (Gln, Q)
n = 1 (0.39%)
Histidine (His, H)
n = 13 (5.1%)
Lysine (Lys, K)
n = 5 (1.96%)
Arginine (Arg, R)
n = 1 (0.39%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 8 3 0 4 1 23 1 0 5 1 8 4 36 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 0 7 2 5 0 7 0 10 2 1 0 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 1 6 0 3 0 2 0 8 3 0 5 11 0 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 4 3 2 4 1 1 0 0 0 7 4 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 27 63 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 37 55 119
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 17 94 120
CYTB (size: 1113 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.68%)
Alanine (Ala, A)
n = 18 (4.86%)
Serine (Ser, S)
n = 30 (8.11%)
Threonine (Thr, T)
n = 21 (5.68%)
Cysteine (Cys, C)
n = 4 (1.08%)
Valine (Val, V)
n = 29 (7.84%)
Leucine (Leu, L)
n = 56 (15.14%)
Isoleucine (Ile, I)
n = 32 (8.65%)
Methionine (Met, M)
n = 18 (4.86%)
Proline (Pro, P)
n = 13 (3.51%)
Phenylalanine (Phe, F)
n = 43 (11.62%)
Tyrosine (Tyr, Y)
n = 19 (5.14%)
Tryptophan (Trp, W)
n = 12 (3.24%)
Aspartic acid (Asp, D)
n = 7 (1.89%)
Glutamic acid (Glu, E)
n = 7 (1.89%)
Asparagine (Asn, N)
n = 13 (3.51%)
Glutamine (Gln, Q)
n = 4 (1.08%)
Histidine (His, H)
n = 7 (1.89%)
Lysine (Lys, K)
n = 13 (3.51%)
Arginine (Arg, R)
n = 3 (0.81%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 3 13 1 0 2 0 42 2 2 14 1 11 3 42 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 2 10 1 7 0 13 0 1 7 4 1 6 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 11 1 6 0 2 0 2 0 17 2 0 11 13 0 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 4 5 2 13 0 2 0 1 0 14 6 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 30 119 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 60 71 178
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 17 141 172
ND1 (size: 876 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (4.12%)
Alanine (Ala, A)
n = 13 (4.47%)
Serine (Ser, S)
n = 36 (12.37%)
Threonine (Thr, T)
n = 7 (2.41%)
Cysteine (Cys, C)
n = 3 (1.03%)
Valine (Val, V)
n = 22 (7.56%)
Leucine (Leu, L)
n = 43 (14.78%)
Isoleucine (Ile, I)
n = 31 (10.65%)
Methionine (Met, M)
n = 14 (4.81%)
Proline (Pro, P)
n = 8 (2.75%)
Phenylalanine (Phe, F)
n = 37 (12.71%)
Tyrosine (Tyr, Y)
n = 16 (5.5%)
Tryptophan (Trp, W)
n = 2 (0.69%)
Aspartic acid (Asp, D)
n = 4 (1.37%)
Glutamic acid (Glu, E)
n = 12 (4.12%)
Asparagine (Asn, N)
n = 8 (2.75%)
Glutamine (Gln, Q)
n = 5 (1.72%)
Histidine (His, H)
n = 2 (0.69%)
Lysine (Lys, K)
n = 9 (3.09%)
Arginine (Arg, R)
n = 7 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 5 11 7 0 2 0 29 5 0 14 0 7 1 37 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 7 2 3 1 3 0 6 3 1 2 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 9 1 7 0 4 1 13 3 0 5 7 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 8 4 4 0 8 1 6 0 0 1 11 3 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 31 88 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 45 57 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 16 108 145
ND2 (size: 849 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (2.84%)
Alanine (Ala, A)
n = 2 (0.71%)
Serine (Ser, S)
n = 29 (10.28%)
Threonine (Thr, T)
n = 16 (5.67%)
Cysteine (Cys, C)
n = 2 (0.71%)
Valine (Val, V)
n = 20 (7.09%)
Leucine (Leu, L)
n = 50 (17.73%)
Isoleucine (Ile, I)
n = 33 (11.7%)
Methionine (Met, M)
n = 9 (3.19%)
Proline (Pro, P)
n = 4 (1.42%)
Phenylalanine (Phe, F)
n = 43 (15.25%)
Tyrosine (Tyr, Y)
n = 12 (4.26%)
Tryptophan (Trp, W)
n = 8 (2.84%)
Aspartic acid (Asp, D)
n = 1 (0.35%)
Glutamic acid (Glu, E)
n = 6 (2.13%)
Asparagine (Asn, N)
n = 21 (7.45%)
Glutamine (Gln, Q)
n = 5 (1.77%)
Histidine (His, H)
n = 1 (0.35%)
Lysine (Lys, K)
n = 12 (4.26%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 0 6 3 1 4 0 29 5 0 10 1 8 1 41 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 0 0 2 0 5 0 2 1 0 0 2 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 0 7 2 5 0 1 2 11 1 3 13 18 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 2 1 0 10 2 0 0 0 0 10 2 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 18 106 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 36 59 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 15 101 138
ND3 (size: 849 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (2.84%)
Alanine (Ala, A)
n = 2 (0.71%)
Serine (Ser, S)
n = 29 (10.28%)
Threonine (Thr, T)
n = 16 (5.67%)
Cysteine (Cys, C)
n = 2 (0.71%)
Valine (Val, V)
n = 20 (7.09%)
Leucine (Leu, L)
n = 50 (17.73%)
Isoleucine (Ile, I)
n = 33 (11.7%)
Methionine (Met, M)
n = 9 (3.19%)
Proline (Pro, P)
n = 4 (1.42%)
Phenylalanine (Phe, F)
n = 43 (15.25%)
Tyrosine (Tyr, Y)
n = 12 (4.26%)
Tryptophan (Trp, W)
n = 8 (2.84%)
Aspartic acid (Asp, D)
n = 1 (0.35%)
Glutamic acid (Glu, E)
n = 6 (2.13%)
Asparagine (Asn, N)
n = 21 (7.45%)
Glutamine (Gln, Q)
n = 5 (1.77%)
Histidine (His, H)
n = 1 (0.35%)
Lysine (Lys, K)
n = 12 (4.26%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 0 6 3 1 4 0 29 5 0 10 1 8 1 41 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 0 0 2 0 5 0 2 1 0 0 2 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 0 7 2 5 0 1 2 11 1 3 13 18 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 2 1 0 10 2 0 0 0 0 10 2 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 18 106 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 36 59 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 15 101 138
ND4 (size: 1230 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.65%)
Alanine (Ala, A)
n = 13 (3.18%)
Serine (Ser, S)
n = 56 (13.69%)
Threonine (Thr, T)
n = 12 (2.93%)
Cysteine (Cys, C)
n = 4 (0.98%)
Valine (Val, V)
n = 27 (6.6%)
Leucine (Leu, L)
n = 66 (16.14%)
Isoleucine (Ile, I)
n = 37 (9.05%)
Methionine (Met, M)
n = 29 (7.09%)
Proline (Pro, P)
n = 10 (2.44%)
Phenylalanine (Phe, F)
n = 57 (13.94%)
Tyrosine (Tyr, Y)
n = 22 (5.38%)
Tryptophan (Trp, W)
n = 7 (1.71%)
Aspartic acid (Asp, D)
n = 2 (0.49%)
Glutamic acid (Glu, E)
n = 9 (2.2%)
Asparagine (Asn, N)
n = 17 (4.16%)
Glutamine (Gln, Q)
n = 2 (0.49%)
Histidine (His, H)
n = 7 (1.71%)
Lysine (Lys, K)
n = 11 (2.69%)
Arginine (Arg, R)
n = 2 (0.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 2 23 8 0 4 1 45 2 0 8 2 14 3 56 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 0 7 0 5 1 9 2 5 3 5 0 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 9 0 15 2 11 0 10 0 17 5 0 8 15 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 1 2 0 9 2 2 0 0 0 14 4 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 34 134 172
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 63 71 216
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 18 162 201
ND4L (size: 234 bases)
Amino acid sequence: IMFLFVSLFMFIFKWQRLIFILISLEFMMLSLFLKFSYVLGEMMFFYFMCFSVISSILGMVVMVGNMKFFGSDNCIF*
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (5.19%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (10.39%)
Threonine (Thr, T)
n = 0 (0%)
Cysteine (Cys, C)
n = 2 (2.6%)
Valine (Val, V)
n = 6 (7.79%)
Leucine (Leu, L)
n = 10 (12.99%)
Isoleucine (Ile, I)
n = 8 (10.39%)
Methionine (Met, M)
n = 10 (12.99%)
Proline (Pro, P)
n = 0 (0%)
Phenylalanine (Phe, F)
n = 16 (20.78%)
Tyrosine (Tyr, Y)
n = 2 (2.6%)
Tryptophan (Trp, W)
n = 1 (1.3%)
Aspartic acid (Asp, D)
n = 1 (1.3%)
Glutamic acid (Glu, E)
n = 2 (2.6%)
Asparagine (Asn, N)
n = 2 (2.6%)
Glutamine (Gln, Q)
n = 1 (1.3%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (3.9%)
Arginine (Arg, R)
n = 1 (1.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 5 0 0 1 1 7 1 0 4 0 2 0 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 0 0 0 0 3 0 0 1 0 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 3 0 1 0 1 0 2 0 0 1 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 3 0 1 0 0 0 3 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 4 27 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 4 12 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 1 26 42
ND5 (size: 1584 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.74%)
Alanine (Ala, A)
n = 12 (2.28%)
Serine (Ser, S)
n = 67 (12.71%)
Threonine (Thr, T)
n = 18 (3.42%)
Cysteine (Cys, C)
n = 6 (1.14%)
Valine (Val, V)
n = 35 (6.64%)
Leucine (Leu, L)
n = 87 (16.51%)
Isoleucine (Ile, I)
n = 32 (6.07%)
Methionine (Met, M)
n = 30 (5.69%)
Proline (Pro, P)
n = 8 (1.52%)
Phenylalanine (Phe, F)
n = 86 (16.32%)
Tyrosine (Tyr, Y)
n = 23 (4.36%)
Tryptophan (Trp, W)
n = 8 (1.52%)
Aspartic acid (Asp, D)
n = 11 (2.09%)
Glutamic acid (Glu, E)
n = 6 (1.14%)
Asparagine (Asn, N)
n = 36 (6.83%)
Glutamine (Gln, Q)
n = 8 (1.52%)
Histidine (His, H)
n = 5 (0.95%)
Lysine (Lys, K)
n = 21 (3.98%)
Arginine (Arg, R)
n = 3 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 4 27 9 0 8 1 57 6 2 15 2 15 3 82 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 6 0 5 2 5 0 13 3 7 2 1 3 3 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 1 10 0 6 2 14 3 16 7 2 12 32 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 2 11 0 15 6 3 0 0 0 21 11 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 42 186 211
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
91 56 111 270
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 34 189 257
ND6 (size: 435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (2.78%)
Alanine (Ala, A)
n = 3 (2.08%)
Serine (Ser, S)
n = 24 (16.67%)
Threonine (Thr, T)
n = 2 (1.39%)
Cysteine (Cys, C)
n = 3 (2.08%)
Valine (Val, V)
n = 13 (9.03%)
Leucine (Leu, L)
n = 23 (15.97%)
Isoleucine (Ile, I)
n = 14 (9.72%)
Methionine (Met, M)
n = 8 (5.56%)
Proline (Pro, P)
n = 3 (2.08%)
Phenylalanine (Phe, F)
n = 22 (15.28%)
Tyrosine (Tyr, Y)
n = 11 (7.64%)
Tryptophan (Trp, W)
n = 2 (1.39%)
Aspartic acid (Asp, D)
n = 1 (0.69%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (2.78%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.69%)
Lysine (Lys, K)
n = 5 (3.47%)
Arginine (Arg, R)
n = 1 (0.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 6 3 0 1 0 17 0 0 5 0 5 3 22 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 0 3 0 0 0 4 0 0 0 1 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 0 3 0 9 0 9 2 2 2 4 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 5 0 1 0 0 0 7 1 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 9 50 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 15 23 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 5 47 83
Total protein-coding genes (size: 10299 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 187 (5.45%)
Alanine (Ala, A)
n = 114 (3.32%)
Serine (Ser, S)
n = 377 (10.98%)
Threonine (Thr, T)
n = 144 (4.2%)
Cysteine (Cys, C)
n = 47 (1.37%)
Valine (Val, V)
n = 253 (7.37%)
Leucine (Leu, L)
n = 530 (15.44%)
Isoleucine (Ile, I)
n = 280 (8.16%)
Methionine (Met, M)
n = 178 (5.19%)
Proline (Pro, P)
n = 81 (2.36%)
Phenylalanine (Phe, F)
n = 452 (13.17%)
Tyrosine (Tyr, Y)
n = 173 (5.04%)
Tryptophan (Trp, W)
n = 71 (2.07%)
Aspartic acid (Asp, D)
n = 63 (1.84%)
Glutamic acid (Glu, E)
n = 78 (2.27%)
Asparagine (Asn, N)
n = 151 (4.4%)
Glutamine (Gln, Q)
n = 44 (1.28%)
Histidine (His, H)
n = 58 (1.69%)
Lysine (Lys, K)
n = 109 (3.18%)
Arginine (Arg, R)
n = 31 (0.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
257 23 134 51 1 36 5 356 34 10 118 9 98 28 429 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 45 2 62 9 39 4 93 5 60 29 27 7 39 8 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 69 6 84 5 51 5 61 6 144 29 9 81 139 12 45
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 52 26 55 8 95 14 29 0 1 1 126 39 10 2 62
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
695 307 1094 1337
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
568 484 688 1693
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
311 159 1262 1701

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.