Viewing data for Camelus dromedarius


Scientific name Camelus dromedarius
Common name Dromedary
Maximum lifespan 28.40 years (Camelus dromedarius@AnAge)

Total mtDNA (size: 16643 bases) GC AT G C A T
Base content (bases) 7001 9642 4423 2578 4510 5132
Base content per 1 kb (bases) 421 579 266 155 271 308
Base content (%) 42.1% 57.9%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4792 6547 3181 1611 3192 3355
Base content per 1 kb (bases) 423 577 281 142 282 296
Base content (%) 42.3% 57.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1506 bases) GC AT G C A T
Base content (bases) 597 909 331 266 410 499
Base content per 1 kb (bases) 396 604 220 177 272 331
Base content (%) 39.6% 60.4%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 1016 1509 538 478 611 898
Base content per 1 kb (bases) 402 598 213 189 242 356
Base content (%) 40.2% 59.8%
12S rRNA gene (size: 966 bases) GC AT G C A T
Base content (bases) 418 548 225 193 216 332
Base content per 1 kb (bases) 433 567 233 200 224 344
Base content (%) 43.3% 56.7%
16S rRNA gene (size: 1559 bases) GC AT G C A T
Base content (bases) 598 961 313 285 395 566
Base content per 1 kb (bases) 384 616 201 183 253 363
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 268 413 183 85 206 207
Base content per 1 kb (bases) 394 606 269 125 302 304
Base content (%) 39.4% 60.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 76 128 53 23 57 71
Base content per 1 kb (bases) 373 627 260 113 279 348
Base content (%) 37.3% 62.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 676 869 385 291 472 397
Base content per 1 kb (bases) 438 562 249 188 306 257
Base content (%) 43.8% 56.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 267 417 162 105 202 215
Base content per 1 kb (bases) 390 610 237 154 295 314
Base content (%) 39.0% 61.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 373 411 231 142 224 187
Base content per 1 kb (bases) 476 524 295 181 286 239
Base content (%) 47.6% 52.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 314 169 322 335
Base content per 1 kb (bases) 424 576 275 148 282 294
Base content (%) 42.4% 57.6%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 442 514 309 133 245 269
Base content per 1 kb (bases) 462 538 323 139 256 281
Base content (%) 46.2% 53.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 389 653 286 103 291 362
Base content per 1 kb (bases) 373 627 274 99 279 347
Base content (%) 37.3% 62.7%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 154 196 103 51 105 91
Base content per 1 kb (bases) 440 560 294 146 300 260
Base content (%) 44.0% 56.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 598 780 402 196 377 403
Base content per 1 kb (bases) 434 566 292 142 274 292
Base content (%) 43.4% 56.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 127 170 84 43 90 80
Base content per 1 kb (bases) 428 572 283 145 303 269
Base content (%) 42.8% 57.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 751 1067 527 224 514 553
Base content per 1 kb (bases) 413 587 290 123 283 304
Base content (%) 41.3% 58.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 210 318 156 54 111 207
Base content per 1 kb (bases) 398 602 295 102 210 392
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 11 6 6 17 3 8 7 1 2 2 6 2 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 10 5 0 1 1 6 3 7 2 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 2 3 2 2 1 1 3 2 0 0 1 7 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 3 1 1 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 66 82 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 63 38 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 54 87 67
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILSMLVTLFVLFQLKISKHIYPSDPSPKSNKTRKQKAPWETKWTKIYLPLLLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 11 (16.42%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 1 2 0 3 2 3 1 3 0 0 2 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 4 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 1 2 0 3 0 0 1 1 1 0 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 2 4 4 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 20 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 13 27 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.34%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 30 (5.84%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 11 16 3 7 27 7 10 4 3 9 10 17 3 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 1 0 13 14 10 3 3 13 21 11 10 9 6 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 3 11 8 7 1 0 3 10 9 2 6 8 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 9 7 8 1 3 3 1 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 104 135 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 134 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 147 167 140
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 3 11 4 2 12 3 9 5 1 1 9 4 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 1 3 1 2 1 4 2 1 5 3 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 4 4 3 5 0 3 2 8 3 1 2 3 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 4 3 7 3 2 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 70 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 53 86 64
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 6 7 3 5 15 7 3 4 3 5 7 5 2 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 12 3 0 2 6 8 4 5 6 0 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 4 4 3 4 8 0 1 5 5 6 2 1 4 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 3 1 2 2 0 1 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 71 56 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 66 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 94 77 60
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 21 9 5 6 24 8 10 5 1 5 2 11 3 4 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 6 8 12 0 4 7 12 2 1 10 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 18 2 4 7 11 1 1 1 8 7 1 2 4 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 5 7 8 1 2 1 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 92 106 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 98 74 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 124 155 75
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 32 (10.09%)
Serine (Ser, S)
n = 19 (5.99%)
Threonine (Thr, T)
n = 26 (8.2%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 18 (5.68%)
Leucine (Leu, L)
n = 51 (16.09%)
Isoleucine (Ile, I)
n = 24 (7.57%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 13 5 13 23 4 5 6 0 1 7 8 2 10 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 3 18 11 0 2 6 4 1 5 9 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 1 3 8 6 0 1 1 4 7 2 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 2 2 1 6 1 0 0 7 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 86 91 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 97 55 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 126 122 47
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 14 (4.05%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.62%)
Leucine (Leu, L)
n = 59 (17.05%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 11 36 5 12 27 5 9 9 1 5 5 6 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 7 4 1 0 6 9 1 4 7 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 1 8 6 11 0 1 4 5 6 0 1 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 1 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 86 141 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 98 58 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 102 163 66
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 14 (4.05%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.62%)
Leucine (Leu, L)
n = 59 (17.05%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 11 36 5 12 27 5 9 9 1 5 5 6 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 7 4 1 0 6 9 1 4 7 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 1 8 6 11 0 1 4 5 6 0 1 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 1 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 86 141 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 98 58 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 102 163 66
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 35 (7.64%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 19 (4.15%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 17 26 11 19 36 12 10 8 3 3 6 6 2 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 3 4 12 13 4 0 10 5 2 5 13 2 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 4 6 11 9 2 4 10 10 9 4 3 6 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 4 1 3 9 3 1 1 6 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 130 157 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 119 85 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 153 161 86
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 6 1 6 11 1 3 2 0 0 2 4 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 1 0 4 3 2 1 3 0 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 3 5 0 0 0 1 2 2 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 25 28 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 18 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 37 34 17
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.3%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 43 (7.11%)
Threonine (Thr, T)
n = 55 (9.09%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 25 (4.13%)
Leucine (Leu, L)
n = 93 (15.37%)
Isoleucine (Ile, I)
n = 54 (8.93%)
Methionine (Met, M)
n = 35 (5.79%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 46 (7.6%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 31 (5.12%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 25 30 21 16 33 3 15 16 3 2 9 10 4 19 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 4 12 21 14 1 1 10 12 3 6 17 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 27 4 2 16 12 1 2 10 7 10 3 5 6 25 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 2 4 7 20 3 1 3 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
121 142 210 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 163 125 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 222 218 128
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 15 (8.57%)
Isoleucine (Ile, I)
n = 19 (10.86%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 16 (9.14%)
Tyrosine (Tyr, Y)
n = 8 (4.57%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 3 4 1 0 1 4 4 0 1 8 1 7 8 14 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 4 0 2 0 7 2 4 12 2 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 5 4 3 0 0 4 1 4 4 1 5 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 5 4 0 1 2 0 0 0 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 11 50 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 30 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 18 31 76
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 262 (6.9%)
Serine (Ser, S)
n = 270 (7.11%)
Threonine (Thr, T)
n = 322 (8.48%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 215 (5.66%)
Leucine (Leu, L)
n = 593 (15.61%)
Isoleucine (Ile, I)
n = 309 (8.13%)
Methionine (Met, M)
n = 246 (6.48%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 235 (6.19%)
Tyrosine (Tyr, Y)
n = 136 (3.58%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 145 (3.82%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
179 130 176 71 99 234 63 96 69 21 41 60 87 27 113 122
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
70 10 15 51 114 83 14 23 71 83 41 55 84 52 9 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
94 133 32 53 76 74 6 18 43 66 70 16 30 53 92 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 69 27 29 41 76 20 11 10 39 7 1 0 6 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
861 917 1180 842
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
476 993 733 1598
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
384 1183 1366 867

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.