Viewing data for Cervus nippon


Scientific name Cervus nippon
Common name Sika deer
Maximum lifespan 26.30 years (Cervus nippon@AnAge)

Total mtDNA (size: 16429 bases) GC AT G C A T
Base content (bases) 6243 10186 4035 2208 4709 5477
Base content per 1 kb (bases) 380 620 246 134 287 333
Base content (%) 38.0% 62.0%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4324 7015 2956 1368 3345 3670
Base content per 1 kb (bases) 381 619 261 121 295 324
Base content (%) 38.1% 61.9%
D-loop (size: 990 bases) GC AT G C A T
Base content (bases) 370 620 215 155 325 295
Base content per 1 kb (bases) 374 626 217 157 328 298
Base content (%) 37.4% 62.6%
Total tRNA-coding genes (size: 1518 bases) GC AT G C A T
Base content (bases) 554 964 316 238 422 542
Base content per 1 kb (bases) 365 635 208 157 278 357
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2529 bases) GC AT G C A T
Base content (bases) 974 1555 537 437 604 951
Base content per 1 kb (bases) 385 615 212 173 239 376
Base content (%) 38.5% 61.5%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 390 566 221 169 215 351
Base content per 1 kb (bases) 408 592 231 177 225 367
Base content (%) 40.8% 59.2%
16S rRNA gene (size: 1573 bases) GC AT G C A T
Base content (bases) 584 989 316 268 389 600
Base content per 1 kb (bases) 371 629 201 170 247 381
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 253 428 177 76 209 219
Base content per 1 kb (bases) 372 628 260 112 307 322
Base content (%) 37.2% 62.8%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 57 144 42 15 64 80
Base content per 1 kb (bases) 284 716 209 75 318 398
Base content (%) 28.4% 71.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 613 932 364 249 485 447
Base content per 1 kb (bases) 397 603 236 161 314 289
Base content (%) 39.7% 60.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 248 436 150 98 200 236
Base content per 1 kb (bases) 363 637 219 143 292 345
Base content (%) 36.3% 63.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 331 453 218 113 236 217
Base content per 1 kb (bases) 422 578 278 144 301 277
Base content (%) 42.2% 57.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 467 673 317 150 320 353
Base content per 1 kb (bases) 410 590 278 132 281 310
Base content (%) 41.0% 59.0%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 378 578 262 116 277 301
Base content per 1 kb (bases) 395 605 274 121 290 315
Base content (%) 39.5% 60.5%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 362 680 272 90 295 385
Base content per 1 kb (bases) 347 653 261 86 283 369
Base content (%) 34.7% 65.3%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 134 213 92 42 105 108
Base content per 1 kb (bases) 386 614 265 121 303 311
Base content (%) 38.6% 61.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 515 863 364 151 428 435
Base content per 1 kb (bases) 374 626 264 110 311 316
Base content (%) 37.4% 62.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 105 192 66 39 100 92
Base content per 1 kb (bases) 354 646 222 131 337 310
Base content (%) 35.4% 64.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 679 1142 490 189 531 611
Base content per 1 kb (bases) 373 627 269 104 292 336
Base content (%) 37.3% 62.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 200 328 154 46 118 210
Base content per 1 kb (bases) 379 621 292 87 223 398
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 8 14 13 3 17 2 7 9 0 2 2 6 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 7 6 0 1 3 8 0 1 3 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 2 2 4 1 1 3 0 2 1 1 8 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 4 0 2 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 66 80 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 38 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 49 101 69
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLMMIMSMFLALFIIFQLKISKHNFHFNPELTLTKTQKQNTPWETKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.67%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 2 1 2 0 5 5 0 0 0 0 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 2 1 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 2 0 1 1 1 0 0 1 0 0 1 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 27 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 17 21 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 8 32 19
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 10 31 7 7 22 7 14 6 0 10 8 19 1 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 13 11 14 1 9 12 19 7 11 6 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 22 0 7 6 15 0 1 2 11 8 3 2 13 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 6 9 9 0 1 2 5 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 102 140 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 129 211 151
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 11 3 2 13 2 12 6 0 4 4 6 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 1 3 0 2 1 5 0 3 1 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 12 2 7 2 7 0 0 5 9 2 0 2 3 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 5 5 5 0 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 52 66 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 43 109 59
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 7 5 3 14 1 9 7 0 5 5 5 0 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 9 3 0 3 7 9 1 2 4 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 1 3 4 8 0 2 3 5 6 1 0 2 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 0 0 3 1 1 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 64 63 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 89 99 65
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 13 5 12 26 4 8 6 0 2 8 8 0 11 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 2 3 18 0 1 6 15 2 3 6 12 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 1 4 5 9 1 0 3 6 9 0 1 7 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 2 3 8 9 0 0 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 95 114 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 90 76 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 132 163 69
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 19 (5.99%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 15 17 4 7 33 2 8 7 0 3 2 8 1 15 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 11 16 0 2 4 2 4 4 9 8 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 4 7 8 1 0 3 6 5 0 0 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 6 1 1 0 5 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 86 93 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 89 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 87 152 64
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 37 4 9 27 1 11 10 0 6 3 4 0 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 6 8 1 0 6 6 2 1 8 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 0 4 6 15 0 0 2 4 4 0 0 9 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 79 149 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 92 178 66
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 37 4 9 27 1 11 10 0 6 3 4 0 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 6 8 1 0 6 6 2 1 8 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 0 4 6 15 0 0 2 4 4 0 0 9 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 79 149 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 92 178 66
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 23 (5.02%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 10 28 14 17 34 3 23 8 3 3 4 10 0 14 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 7 9 10 0 2 8 6 2 6 5 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 0 6 11 12 1 4 7 8 9 2 2 7 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 0 0 3 10 1 0 2 6 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 120 155 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 112 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 132 195 109
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 8 4 1 10 1 6 2 0 2 1 4 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 1 2 5 1 0 1 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 2 4 3 0 0 1 4 0 0 0 4 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 22 26 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 20 48 25
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 15 (2.48%)
Leucine (Leu, L)
n = 84 (13.86%)
Isoleucine (Ile, I)
n = 63 (10.4%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 49 (8.09%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 35 38 10 14 37 5 18 16 3 4 3 8 0 21 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 6 15 20 1 4 11 11 2 7 10 8 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 31 1 6 15 12 2 4 8 11 7 0 0 15 22 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 3 8 22 0 3 2 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 130 233 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 160 131 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 200 247 142
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 3 1 1 0 2 11 1 1 8 0 5 10 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 2 1 1 2 9 1 8 8 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 2 4 1 0 2 4 0 5 5 3 3 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 1 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 10 48 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 10 37 79
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 244 (6.42%)
Serine (Ser, S)
n = 276 (7.27%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 188 (4.95%)
Leucine (Leu, L)
n = 585 (15.4%)
Isoleucine (Ile, I)
n = 334 (8.79%)
Methionine (Met, M)
n = 261 (6.87%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 255 (6.71%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 168 (4.42%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
195 139 216 78 80 246 30 136 86 7 50 40 84 14 140 115
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 4 18 49 82 107 6 34 60 94 29 44 56 84 6 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
69 169 9 49 66 97 9 18 37 72 58 10 15 80 88 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 80 17 23 43 89 6 8 13 37 5 1 0 7 0 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
812 873 1224 890
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 965 749 1623
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
208 1022 1627 942

Failed to understand id: ?term=("Cervus nippon"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.