Viewing data for Ceryle rudis


Scientific name Ceryle rudis
Common name Pied kingfisher
Maximum lifespan 3.90 years (Ceryle rudis@AnAge)

Total mtDNA (size: 17355 bases) GC AT G C A T
Base content (bases) 7654 9701 5356 2298 4134 5567
Base content per 1 kb (bases) 441 559 309 132 238 321
Base content (%) 44.1% 55.9%
Total protein-coding genes (size: 11376 bases) GC AT G C A T
Base content (bases) 5169 6207 3828 1341 2686 3521
Base content per 1 kb (bases) 454 546 336 118 236 310
Base content (%) 45.4% 54.6%
D-loop (size: 1874 bases) GC AT G C A T
Base content (bases) 652 1222 434 218 543 679
Base content per 1 kb (bases) 348 652 232 116 290 362
Base content (%) 34.8% 65.2%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 659 892 390 269 379 513
Base content per 1 kb (bases) 425 575 251 173 244 331
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2556 bases) GC AT G C A T
Base content (bases) 1165 1391 682 483 535 856
Base content per 1 kb (bases) 456 544 267 189 209 335
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 971 bases) GC AT G C A T
Base content (bases) 466 505 270 196 194 311
Base content per 1 kb (bases) 480 520 278 202 200 320
Base content (%) 48.0% 52.0%
16S rRNA gene (size: 1585 bases) GC AT G C A T
Base content (bases) 699 886 412 287 341 545
Base content per 1 kb (bases) 441 559 260 181 215 344
Base content (%) 44.1% 55.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 304 380 240 64 169 211
Base content per 1 kb (bases) 444 556 351 94 247 308
Base content (%) 44.4% 55.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 65 103 58 7 39 64
Base content per 1 kb (bases) 387 613 345 42 232 381
Base content (%) 38.7% 61.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 711 840 468 243 402 438
Base content per 1 kb (bases) 458 542 302 157 259 282
Base content (%) 45.8% 54.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 310 374 217 93 155 219
Base content per 1 kb (bases) 453 547 317 136 227 320
Base content (%) 45.3% 54.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 364 420 256 108 186 234
Base content per 1 kb (bases) 464 536 327 138 237 298
Base content (%) 46.4% 53.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 529 614 394 135 289 325
Base content per 1 kb (bases) 463 537 345 118 253 284
Base content (%) 46.3% 53.7%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 436 542 314 122 263 279
Base content per 1 kb (bases) 446 554 321 125 269 285
Base content (%) 44.6% 55.4%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 447 592 344 103 240 352
Base content per 1 kb (bases) 430 570 331 99 231 339
Base content (%) 43.0% 57.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 163 189 123 40 86 103
Base content per 1 kb (bases) 463 537 349 114 244 293
Base content (%) 46.3% 53.7%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 647 730 508 139 308 422
Base content per 1 kb (bases) 470 530 369 101 224 306
Base content (%) 47.0% 53.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 134 163 96 38 77 86
Base content per 1 kb (bases) 451 549 323 128 259 290
Base content (%) 45.1% 54.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 820 995 618 202 419 576
Base content per 1 kb (bases) 452 548 340 111 231 317
Base content (%) 45.2% 54.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 244 278 195 49 57 221
Base content per 1 kb (bases) 467 533 374 94 109 423
Base content (%) 46.7% 53.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 14 11 7 9 37 2 3 7 1 0 4 2 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 9 3 0 1 4 2 1 4 7 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 1 3 8 0 0 4 0 3 0 1 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 0 1 3 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 88 73 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 87 102 30
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLLSWTAFSLIIQPKISSFISTNTPLNKPQTTTKTTSWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 1 0 1 2 0 2 3 0 0 0 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 0 2 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 0 2 4 0 0 0 0 0 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 13 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 11 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 21 29 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 32 (6.2%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 25 20 4 13 30 2 11 9 0 6 6 21 1 12 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 11 19 17 0 5 22 19 1 7 11 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 1 3 10 9 1 0 3 3 15 0 1 2 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 11 0 3 11 8 1 0 3 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 117 134 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 143 95 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 208 209 87
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 8 5 6 17 0 3 7 0 1 9 4 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 7 4 0 0 2 5 1 1 4 9 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 2 4 11 0 0 3 0 9 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 1 1 12 4 0 0 2 1 2 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 62 56 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 58 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 97 101 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 9 2 8 19 0 3 8 1 2 5 5 0 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 11 7 0 2 5 12 0 2 6 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 1 6 6 0 0 5 0 9 1 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 3 1 4 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 71 65 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 118 114 26
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 25 9 3 20 34 1 4 8 0 3 7 5 1 3 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 1 17 9 0 3 11 11 0 3 9 12 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 5 7 13 0 0 1 3 10 1 0 5 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 3 3 9 1 2 1 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 111 101 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 105 77 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 178 147 50
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 23 (7.08%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 12 (3.69%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 26 (8.0%)
Methionine (Met, M)
n = 16 (4.92%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 7 (2.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 17 13 8 13 32 2 7 3 2 1 3 8 0 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 13 10 0 0 8 3 2 5 4 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 7 1 4 12 7 0 2 3 3 11 2 1 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 7 0 1 2 4 0 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 93 91 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 99 56 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 122 132 56
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 46 (13.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 30 (8.7%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 11 (3.19%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 16 3 14 28 5 13 10 0 1 3 3 1 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 8 11 10 0 1 3 8 0 2 5 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 26 2 1 14 11 0 1 4 2 4 2 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 0 0 2 11 3 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 95 127 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 127 165 37
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 46 (13.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 30 (8.7%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 11 (3.19%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 16 3 14 28 5 13 10 0 1 3 3 1 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 8 11 10 0 1 3 8 0 2 5 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 26 2 1 14 11 0 1 4 2 4 2 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 0 0 2 11 3 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 95 127 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 127 165 37
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 52 (11.35%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 30 (6.55%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 34 19 7 28 53 3 6 11 1 1 2 3 1 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 3 14 12 0 4 8 5 1 4 13 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 18 3 1 14 10 0 2 10 2 11 1 0 3 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 1 0 2 10 0 0 5 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 160 158 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 136 80 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 212 184 45
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 4 2 2 12 0 3 2 0 0 1 3 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 4 3 0 1 1 2 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 2 4 5 0 0 3 0 2 0 1 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 28 23 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 17 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 37 46 12
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 49 (8.11%)
Serine (Ser, S)
n = 46 (7.62%)
Threonine (Thr, T)
n = 73 (12.09%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 12 (1.99%)
Leucine (Leu, L)
n = 101 (16.72%)
Isoleucine (Ile, I)
n = 50 (8.28%)
Methionine (Met, M)
n = 37 (6.13%)
Proline (Pro, P)
n = 31 (5.13%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 30 (4.97%)
Glutamine (Gln, Q)
n = 19 (3.15%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 34 31 13 22 52 2 10 16 3 0 8 4 0 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 5 7 29 13 0 6 13 12 1 2 11 17 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 31 2 6 22 7 1 0 10 0 13 1 2 1 29 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 1 2 5 21 0 1 4 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 162 221 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 189 116 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 267 239 78
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 14 (8.09%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 1 (0.58%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 33 (19.08%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 7 (4.05%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 2 1 0 3 10 0 1 17 0 2 14 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 2 6 0 5 3 6 1 2 18 1 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 0 3 2 0 6 1 3 12 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 7 0 0 0 1 1 0 2 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 15 14 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 27 20 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 7 23 74
Total protein-coding genes (size: 11393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 285 (7.51%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 356 (9.38%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 648 (17.07%)
Isoleucine (Ile, I)
n = 296 (7.8%)
Methionine (Met, M)
n = 183 (4.82%)
Proline (Pro, P)
n = 226 (5.95%)
Phenylalanine (Phe, F)
n = 223 (5.87%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
91 205 143 58 148 328 20 76 87 9 32 48 64 18 60 163
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 7 24 49 139 94 3 29 80 84 25 33 74 115 4 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
146 154 9 32 102 93 5 7 47 20 89 11 18 24 116 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 84 10 20 44 81 5 6 22 37 5 0 2 8 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
823 1053 1117 804
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1099 705 1512
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
185 1533 1543 536

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.