Viewing data for Stercorarius maccormicki


Scientific name Stercorarius maccormicki
Common name South polar skua
Maximum lifespan 23.50 years (Stercorarius maccormicki@AnAge)

Total mtDNA (size: 16669 bases) GC AT G C A T
Base content (bases) 7445 9224 5142 2303 4066 5158
Base content per 1 kb (bases) 447 553 308 138 244 309
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 5113 6269 3726 1387 2807 3462
Base content per 1 kb (bases) 449 551 327 122 247 304
Base content (%) 44.9% 55.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1555 bases) GC AT G C A T
Base content (bases) 644 911 379 265 400 511
Base content per 1 kb (bases) 414 586 244 170 257 329
Base content (%) 41.4% 58.6%
Total rRNA-coding genes (size: 2579 bases) GC AT G C A T
Base content (bases) 1212 1367 710 502 530 837
Base content per 1 kb (bases) 470 530 275 195 206 325
Base content (%) 47.0% 53.0%
12S rRNA gene (size: 981 bases) GC AT G C A T
Base content (bases) 491 490 279 212 197 293
Base content per 1 kb (bases) 501 499 284 216 201 299
Base content (%) 50.1% 49.9%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 721 877 431 290 333 544
Base content per 1 kb (bases) 451 549 270 181 208 340
Base content (%) 45.1% 54.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 240 65 178 201
Base content per 1 kb (bases) 446 554 351 95 260 294
Base content (%) 44.6% 55.4%
ATP8 (size: 174 bases) GC AT G C A T
Base content (bases) 74 100 65 9 38 62
Base content per 1 kb (bases) 425 575 374 52 218 356
Base content (%) 42.5% 57.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 723 828 473 250 396 432
Base content per 1 kb (bases) 466 534 305 161 255 279
Base content (%) 46.6% 53.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 209 96 172 207
Base content per 1 kb (bases) 446 554 306 140 251 303
Base content (%) 44.6% 55.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 356 428 240 116 196 232
Base content per 1 kb (bases) 454 546 306 148 250 296
Base content (%) 45.4% 54.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 526 617 384 142 286 331
Base content per 1 kb (bases) 460 540 336 124 250 290
Base content (%) 46.0% 54.0%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 445 533 308 137 274 259
Base content per 1 kb (bases) 455 545 315 140 280 265
Base content (%) 45.5% 54.5%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 435 604 335 100 261 343
Base content per 1 kb (bases) 419 581 322 96 251 330
Base content (%) 41.9% 58.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 156 195 114 42 96 99
Base content per 1 kb (bases) 444 556 325 120 274 282
Base content (%) 44.4% 55.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 610 768 475 135 344 424
Base content per 1 kb (bases) 443 557 345 98 250 308
Base content (%) 44.3% 55.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 132 165 90 42 75 90
Base content per 1 kb (bases) 444 556 303 141 253 303
Base content (%) 44.4% 55.6%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 804 1011 600 204 435 576
Base content per 1 kb (bases) 443 557 331 112 240 317
Base content (%) 44.3% 55.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 246 276 195 51 61 215
Base content per 1 kb (bases) 471 529 374 98 117 412
Base content (%) 47.1% 52.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 9 3 14 34 0 11 8 0 1 4 2 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 8 6 0 2 4 3 0 3 8 5 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 6 0 3 3 2 0 0 4 0 3 1 0 1 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 2 1 1 0 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 85 68 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 66 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 89 100 35
ATP8 (size: 174 bases)
Amino acid sequence: MPQLNPNPWFLIMLAAWLIFTLTIQPKLLSFTSTNPPSNSNKTPMTTKITPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.51%)
Serine (Ser, S)
n = 4 (7.02%)
Threonine (Thr, T)
n = 10 (17.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.28%)
Isoleucine (Ile, I)
n = 4 (7.02%)
Methionine (Met, M)
n = 3 (5.26%)
Proline (Pro, P)
n = 9 (15.79%)
Phenylalanine (Phe, F)
n = 3 (5.26%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (8.77%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (8.77%)
Glutamine (Gln, Q)
n = 2 (3.51%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.26%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 2 1 1 3 1 1 2 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 2 0 0 0 0 0 1 4 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 1 0 1 1 2 0 0 0 0 0 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 25 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 11 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 23 26 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 20 7 12 35 2 7 7 2 3 9 18 4 11 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 25 14 1 10 14 20 3 3 13 15 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 1 9 14 0 0 3 7 11 0 0 4 11 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 2 13 7 2 1 1 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 123 135 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 95 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 209 202 84
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 13 (5.73%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 9 6 7 12 2 4 7 0 6 2 7 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 4 5 5 0 2 2 3 1 2 4 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 3 0 3 5 10 0 0 4 0 8 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 1 4 10 4 0 1 1 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 61 54 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 61 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 90 92 40
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 8 1 8 17 1 4 8 0 1 9 4 1 4 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 2 14 1 1 4 14 0 3 5 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 0 2 6 7 0 0 5 0 10 0 1 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 2 0 4 4 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 68 58 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 105 119 30
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 20 (5.26%)
Threonine (Thr, T)
n = 30 (7.89%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 67 (17.63%)
Isoleucine (Ile, I)
n = 31 (8.16%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 26 (6.84%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 24 8 6 16 38 1 6 7 1 4 6 5 1 6 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 3 14 9 0 7 5 10 3 1 9 15 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 10 1 2 5 11 1 0 1 2 11 1 0 4 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 2 1 5 10 0 1 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 116 102 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 101 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 167 150 51
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 13 (4.0%)
Proline (Pro, P)
n = 23 (7.08%)
Phenylalanine (Phe, F)
n = 19 (5.85%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 5 10 17 26 4 8 5 1 3 1 8 2 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 2 7 12 9 1 2 3 5 3 6 5 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 5 8 8 2 2 3 5 10 1 2 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 2 2 6 1 2 2 3 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 97 81 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 116 120 61
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 50 (14.49%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 16 7 14 28 6 6 9 0 0 6 5 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 6 10 11 0 2 2 8 0 3 5 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 22 0 3 9 15 0 0 3 2 6 0 2 3 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 0 11 2 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 95 126 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 122 59 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 118 158 56
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 50 (14.49%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 16 7 14 28 6 6 9 0 0 6 5 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 6 10 11 0 2 2 8 0 3 5 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 22 0 3 9 15 0 0 3 2 6 0 2 3 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 0 11 2 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 95 126 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 122 59 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 118 158 56
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 46 (10.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 103 (22.49%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 29 21 8 27 56 2 10 13 0 2 2 6 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 9 12 10 0 5 4 6 2 5 12 8 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 19 0 5 10 15 2 0 10 2 11 0 0 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 1 0 2 10 0 0 5 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 160 146 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 136 78 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 179 200 67
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 4 1 3 13 0 3 2 0 0 1 2 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 0 2 3 3 1 1 1 2 0 0 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 2 1 4 5 0 0 4 2 0 0 1 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 29 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 18 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 31 48 13
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 47 (7.78%)
Serine (Ser, S)
n = 50 (8.28%)
Threonine (Thr, T)
n = 71 (11.75%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 103 (17.05%)
Isoleucine (Ile, I)
n = 55 (9.11%)
Methionine (Met, M)
n = 32 (5.3%)
Proline (Pro, P)
n = 28 (4.64%)
Phenylalanine (Phe, F)
n = 33 (5.46%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 28 (4.64%)
Glutamine (Gln, Q)
n = 21 (3.48%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 39 29 11 30 47 6 8 20 1 3 3 7 0 8 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 9 27 10 1 7 7 17 1 2 10 15 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 28 1 5 16 15 2 1 11 2 10 4 1 6 22 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 1 1 5 21 0 0 5 4 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 165 220 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 184 114 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 251 242 90
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 14 (8.09%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 33 (19.08%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 3 0 0 3 4 0 1 14 2 10 7 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 0 4 1 7 1 6 0 3 20 3 0 0 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 7 0 1 2 4 0 7 0 5 16 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 3 1 0 0 2 0 0 2 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 16 17 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 31 16 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 4 28 74
Total protein-coding genes (size: 11399 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.79%)
Alanine (Ala, A)
n = 289 (7.61%)
Serine (Ser, S)
n = 291 (7.66%)
Threonine (Thr, T)
n = 347 (9.14%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 176 (4.64%)
Leucine (Leu, L)
n = 671 (17.67%)
Isoleucine (Ile, I)
n = 288 (7.58%)
Methionine (Met, M)
n = 171 (4.5%)
Proline (Pro, P)
n = 219 (5.77%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 108 (2.84%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
88 200 134 68 156 321 28 75 92 6 37 46 76 17 60 161
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 10 18 59 121 103 6 45 48 94 33 32 77 100 10 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
146 133 6 41 80 105 9 7 49 29 82 12 23 30 104 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 81 11 14 47 79 6 9 18 40 3 1 2 5 1 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
838 1069 1084 807
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
485 1090 696 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
210 1425 1535 628

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.