Viewing data for Acipenser schrenckii


Scientific name Acipenser schrenckii
Common name Amur sturgeon
Maximum lifespan 60.00 years (Acipenser schrenckii@AnAge)

Total mtDNA (size: 16684 bases) GC AT G C A T
Base content (bases) 7642 9042 4899 2743 4025 5017
Base content per 1 kb (bases) 458 542 294 164 241 301
Base content (%) 45.8% 54.2%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5328 6084 3613 1715 2793 3291
Base content per 1 kb (bases) 467 533 317 150 245 288
Base content (%) 46.7% 53.3%
D-loop (size: 971 bases) GC AT G C A T
Base content (bases) 357 614 201 156 313 301
Base content per 1 kb (bases) 368 632 207 161 322 310
Base content (%) 36.8% 63.2%
Total tRNA-coding genes (size: 1549 bases) GC AT G C A T
Base content (bases) 680 869 374 306 389 480
Base content per 1 kb (bases) 439 561 241 198 251 310
Base content (%) 43.9% 56.1%
Total rRNA-coding genes (size: 2662 bases) GC AT G C A T
Base content (bases) 1225 1437 682 543 515 922
Base content per 1 kb (bases) 460 540 256 204 193 346
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 961 bases) GC AT G C A T
Base content (bases) 475 486 268 207 179 307
Base content per 1 kb (bases) 494 506 279 215 186 319
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1701 bases) GC AT G C A T
Base content (bases) 750 951 414 336 336 615
Base content per 1 kb (bases) 441 559 243 198 198 362
Base content (%) 44.1% 55.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 328 356 236 92 173 183
Base content per 1 kb (bases) 480 520 345 135 253 268
Base content (%) 48.0% 52.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 68 100 49 19 44 56
Base content per 1 kb (bases) 405 595 292 113 262 333
Base content (%) 40.5% 59.5%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 750 804 450 300 420 384
Base content per 1 kb (bases) 483 517 290 193 270 247
Base content (%) 48.3% 51.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 310 381 193 117 168 213
Base content per 1 kb (bases) 449 551 279 169 243 308
Base content (%) 44.9% 55.1%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 376 409 243 133 197 212
Base content per 1 kb (bases) 479 521 310 169 251 270
Base content (%) 47.9% 52.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 525 616 359 166 300 316
Base content per 1 kb (bases) 460 540 315 145 263 277
Base content (%) 46.0% 54.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 450 525 310 140 252 273
Base content per 1 kb (bases) 462 538 318 144 258 280
Base content (%) 46.2% 53.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 484 561 347 137 231 330
Base content per 1 kb (bases) 463 537 332 131 221 316
Base content (%) 46.3% 53.7%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 168 181 106 62 101 80
Base content per 1 kb (bases) 481 519 304 178 289 229
Base content (%) 48.1% 51.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 643 738 433 210 339 399
Base content per 1 kb (bases) 466 534 314 152 245 289
Base content (%) 46.6% 53.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 147 150 105 42 76 74
Base content per 1 kb (bases) 495 505 354 141 256 249
Base content (%) 49.5% 50.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 836 1006 600 236 439 567
Base content per 1 kb (bases) 454 546 326 128 238 308
Base content (%) 45.4% 54.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 249 273 186 63 59 214
Base content per 1 kb (bases) 477 523 356 121 113 410
Base content (%) 47.7% 52.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 8 7 15 17 10 7 9 0 3 3 7 1 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 7 0 1 6 4 0 1 11 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 1 0 1 1 0 0 5 0 3 2 0 0 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 0 3 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 85 67 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 33 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 93 83 35
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFMILIFSWLIFLIILPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 1 1 0 2 1 2 1 0 0 0 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 4 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 20 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 16 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 22 11
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 15 8 9 22 10 11 5 3 5 11 18 10 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 8 27 10 3 5 20 17 5 4 12 10 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 5 9 8 3 0 4 7 12 3 2 5 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 3 3 12 7 1 2 2 2 2 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 112 125 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 201 164 94
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 7 4 5 13 3 3 8 0 3 4 10 3 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 2 6 5 2 0 3 4 2 1 6 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 2 1 8 5 0 1 2 5 5 1 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 15 1 1 11 4 0 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 63 53 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 76 95 39
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 5 6 6 11 4 4 9 0 2 8 6 1 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 9 11 1 0 8 9 3 1 5 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 2 3 3 3 0 0 3 3 9 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 1 4 2 0 0 2 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 69 55 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 106 101 39
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 20 8 9 18 20 4 6 9 0 1 7 12 4 13 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 17 8 0 3 9 14 2 0 10 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 6 7 8 0 0 1 4 9 1 2 5 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 2 9 8 1 0 0 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 101 95 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 163 142 57
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 9 (2.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 12 3 15 29 4 9 5 1 3 2 7 3 9 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 16 13 1 3 8 4 2 4 7 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 3 8 5 1 1 1 6 8 0 1 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 0 4 5 2 1 1 7 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 95 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 94 61 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 121 131 51
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 17 7 13 26 9 6 11 3 1 3 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 2 21 12 1 1 8 4 3 0 11 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 21 1 3 6 9 0 4 3 3 6 2 1 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 1 9 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 96 130 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 121 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 130 142 45
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 17 7 13 26 9 6 11 3 1 3 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 2 21 12 1 1 8 4 3 0 11 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 21 1 3 6 9 0 4 3 3 6 2 1 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 1 9 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 96 130 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 121 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 130 142 45
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 41 (8.93%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 28 (6.1%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 18 12 15 35 12 11 10 2 4 4 8 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 3 3 3 21 16 1 3 8 9 6 5 10 11 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 13 2 0 13 10 0 0 7 4 10 2 1 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 2 0 3 9 1 0 3 8 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 133 139 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 130 74 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 170 186 63
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 4 3 8 8 1 3 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 3 0 0 2 3 1 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 3 3 1 0 0 2 0 1 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 21 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 43 37 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 50 (8.16%)
Serine (Ser, S)
n = 45 (7.34%)
Threonine (Thr, T)
n = 64 (10.44%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 23 (3.75%)
Leucine (Leu, L)
n = 94 (15.33%)
Isoleucine (Ile, I)
n = 55 (8.97%)
Methionine (Met, M)
n = 27 (4.4%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 40 (6.53%)
Tyrosine (Tyr, Y)
n = 11 (1.79%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 31 (5.06%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 31 22 7 27 44 5 10 19 3 2 8 10 3 17 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 6 1 34 14 1 2 11 13 5 1 13 13 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 25 2 3 17 12 0 2 11 4 7 3 1 4 27 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 4 8 20 2 0 2 5 2 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
127 160 212 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 176 126 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 264 229 85
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 28 (16.18%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 6 1 1 2 8 0 0 9 2 4 13 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 8 0 3 7 7 0 3 14 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 5 1 1 3 2 0 7 2 5 14 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 0 0 1 2 0 0 2 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 19 16 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 36 22 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 8 21 75
Total protein-coding genes (size: 11434 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 242 (6.36%)
Alanine (Ala, A)
n = 336 (8.82%)
Serine (Ser, S)
n = 236 (6.2%)
Threonine (Thr, T)
n = 311 (8.17%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 218 (5.72%)
Leucine (Leu, L)
n = 628 (16.49%)
Isoleucine (Ile, I)
n = 288 (7.56%)
Methionine (Met, M)
n = 175 (4.6%)
Proline (Pro, P)
n = 214 (5.62%)
Phenylalanine (Phe, F)
n = 221 (5.8%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 74 (1.94%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 131 (3.44%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
130 158 119 78 135 238 68 86 90 14 34 55 87 42 99 122
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 8 21 37 171 111 17 25 86 86 45 25 94 83 12 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 125 13 33 81 65 7 10 40 45 72 20 23 30 101 18
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 84 17 17 57 69 10 5 16 47 7 0 0 5 2 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
971 1015 1034 789
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
516 1047 716 1530
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
353 1432 1395 629

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.