Viewing data for Cavia porcellus


Scientific name Cavia porcellus
Common name Guinea pig
Maximum lifespan 12.00 years (Cavia porcellus@AnAge)

Total mtDNA (size: 16801 bases) GC AT G C A T
Base content (bases) 6605 10196 4155 2450 4805 5391
Base content per 1 kb (bases) 393 607 247 146 286 321
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4431 6918 2940 1491 3404 3514
Base content per 1 kb (bases) 390 610 259 131 300 310
Base content (%) 39.0% 61.0%
D-loop (size: 1357 bases) GC AT G C A T
Base content (bases) 612 745 358 254 334 411
Base content per 1 kb (bases) 451 549 264 187 246 303
Base content (%) 45.1% 54.9%
Total tRNA-coding genes (size: 1503 bases) GC AT G C A T
Base content (bases) 566 937 320 246 419 518
Base content per 1 kb (bases) 377 623 213 164 279 345
Base content (%) 37.7% 62.3%
Total rRNA-coding genes (size: 2508 bases) GC AT G C A T
Base content (bases) 960 1548 510 450 632 916
Base content per 1 kb (bases) 383 617 203 179 252 365
Base content (%) 38.3% 61.7%
12S rRNA gene (size: 943 bases) GC AT G C A T
Base content (bases) 388 555 206 182 224 331
Base content per 1 kb (bases) 411 589 218 193 238 351
Base content (%) 41.1% 58.9%
16S rRNA gene (size: 1565 bases) GC AT G C A T
Base content (bases) 572 993 304 268 408 585
Base content per 1 kb (bases) 365 635 194 171 261 374
Base content (%) 36.5% 63.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 274 407 199 75 199 208
Base content per 1 kb (bases) 402 598 292 110 292 305
Base content (%) 40.2% 59.8%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 66 138 52 14 62 76
Base content per 1 kb (bases) 324 676 255 69 304 373
Base content (%) 32.4% 67.6%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 631 911 344 287 509 402
Base content per 1 kb (bases) 409 591 223 186 330 261
Base content (%) 40.9% 59.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 258 426 163 95 201 225
Base content per 1 kb (bases) 377 623 238 139 294 329
Base content (%) 37.7% 62.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 315 469 189 126 246 223
Base content per 1 kb (bases) 402 598 241 161 314 284
Base content (%) 40.2% 59.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 511 629 348 163 312 317
Base content per 1 kb (bases) 448 552 305 143 274 278
Base content (%) 44.8% 55.2%
ND1 (size: 960 bases) GC AT G C A T
Base content (bases) 392 568 272 120 278 290
Base content per 1 kb (bases) 408 592 283 125 290 302
Base content (%) 40.8% 59.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 383 661 286 97 302 359
Base content per 1 kb (bases) 367 633 274 93 289 344
Base content (%) 36.7% 63.3%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 129 218 84 45 112 106
Base content per 1 kb (bases) 372 628 242 130 323 305
Base content (%) 37.2% 62.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 512 866 363 149 409 457
Base content per 1 kb (bases) 372 628 263 108 297 332
Base content (%) 37.2% 62.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 105 192 69 36 102 90
Base content per 1 kb (bases) 354 646 232 121 343 303
Base content (%) 35.4% 64.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 676 1136 456 220 559 577
Base content per 1 kb (bases) 373 627 252 121 308 318
Base content (%) 37.3% 62.7%
ND6 (size: 531 bases) GC AT G C A T
Base content (bases) 195 336 127 68 131 205
Base content per 1 kb (bases) 367 633 239 128 247 386
Base content (%) 36.7% 63.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 29 (12.83%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 12 9 2 5 21 4 12 5 2 1 3 4 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 7 5 0 2 1 6 1 3 6 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 2 5 2 1 1 2 1 2 0 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 4 1 1 2 0 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 64 84 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 64 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 71 88 52
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTVILSMIISLFMLLQLKISSHSFYLDPKTMSLKTTKHNLPWENKWTKTYLPLSLHLH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 13 (19.4%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 4 (5.97%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 2 (2.99%)
Histidine (His, H)
n = 4 (5.97%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 3 1 1 2 1 6 1 1 0 1 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 2 4 1 0 0 1 1 0 2 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 1 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 15 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 20 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 17 32 12
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 40 (7.8%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 36 (7.02%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.6%)
Leucine (Leu, L)
n = 61 (11.89%)
Isoleucine (Ile, I)
n = 36 (7.02%)
Methionine (Met, M)
n = 32 (6.24%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.12%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 10 24 6 7 10 8 24 5 1 14 7 13 5 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 17 8 14 1 12 10 17 8 15 4 7 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 4 7 8 12 1 0 3 15 4 7 6 7 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 4 5 11 8 1 2 0 5 1 0 1 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 91 134 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 132 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 121 173 162
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 5 (2.2%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 13 7 3 9 3 10 5 0 3 3 5 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 4 3 1 0 1 4 1 2 5 1 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 1 3 3 10 0 2 2 7 4 0 1 4 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 3 4 6 4 1 2 1 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 68 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 54 95 63
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 25 (9.62%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 9 6 4 7 2 10 8 0 5 1 10 0 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 8 3 6 1 4 4 10 2 2 2 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 6 3 9 2 0 5 7 6 2 3 4 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 1 2 2 2 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 57 58 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 66 108 69
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 14 (3.69%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 10 7 14 26 5 9 5 1 4 3 5 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 6 12 8 0 3 5 12 5 2 8 11 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 4 3 9 9 1 0 4 6 10 2 2 4 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 1 5 1 9 10 0 1 2 5 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 102 106 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 96 77 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 150 134 67
ND1 (size: 960 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.08%)
Alanine (Ala, A)
n = 27 (8.46%)
Serine (Ser, S)
n = 22 (6.9%)
Threonine (Thr, T)
n = 23 (7.21%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.39%)
Leucine (Leu, L)
n = 58 (18.18%)
Isoleucine (Ile, I)
n = 27 (8.46%)
Methionine (Met, M)
n = 20 (6.27%)
Proline (Pro, P)
n = 21 (6.58%)
Phenylalanine (Phe, F)
n = 21 (6.58%)
Tyrosine (Tyr, Y)
n = 9 (2.82%)
Tryptophan (Trp, W)
n = 9 (2.82%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.45%)
Asparagine (Asn, N)
n = 16 (5.02%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 18 17 8 8 20 4 16 5 1 3 4 7 0 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 6 9 11 1 3 5 2 3 3 5 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 1 2 10 9 0 0 1 3 6 2 2 6 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 3 0 7 0 1 2 5 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 78 94 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 92 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 102 140 58
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 33 (9.51%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 18 (5.19%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 18 31 8 7 21 6 16 12 0 1 2 3 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 9 6 3 2 3 6 3 6 6 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 1 4 4 19 0 1 2 7 5 2 1 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 0 12 0 0 0 3 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 85 133 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 65 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 100 161 65
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 33 (9.51%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 18 (5.19%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 18 31 8 7 21 6 16 12 0 1 2 3 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 9 6 3 2 3 6 3 6 6 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 1 4 4 19 0 1 2 7 5 2 1 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 0 12 0 0 0 3 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 85 133 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 65 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 100 161 65
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 45 (9.83%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 90 (19.65%)
Isoleucine (Ile, I)
n = 49 (10.7%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 27 31 11 13 30 5 29 10 0 2 4 5 2 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 5 7 13 1 2 8 7 1 6 2 11 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 1 5 12 10 0 3 7 6 12 2 2 10 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 2 4 1 12 1 1 2 5 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 111 171 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 120 86 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 132 200 102
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 8 1 1 7 2 6 2 0 1 0 4 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 4 2 0 0 3 1 1 0 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 2 6 0 0 0 2 2 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 18 29 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 18 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 28 43 21
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.48%)
Alanine (Ala, A)
n = 43 (7.13%)
Serine (Ser, S)
n = 65 (10.78%)
Threonine (Thr, T)
n = 51 (8.46%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 26 (4.31%)
Leucine (Leu, L)
n = 90 (14.93%)
Isoleucine (Ile, I)
n = 53 (8.79%)
Methionine (Met, M)
n = 37 (6.14%)
Proline (Pro, P)
n = 21 (3.48%)
Phenylalanine (Phe, F)
n = 43 (7.13%)
Tyrosine (Tyr, Y)
n = 20 (3.32%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 12 (1.99%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 30 (4.98%)
Glutamine (Gln, Q)
n = 17 (2.82%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 20 (3.32%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 23 31 13 8 33 6 29 14 3 12 1 12 1 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 6 5 17 21 0 1 5 18 3 5 6 9 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 22 1 13 12 25 2 5 8 12 8 6 1 12 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 3 9 16 4 0 2 6 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 117 204 165
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 167 121 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 172 252 145
ND6 (size: 531 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.36%)
Alanine (Ala, A)
n = 12 (6.82%)
Serine (Ser, S)
n = 13 (7.39%)
Threonine (Thr, T)
n = 7 (3.98%)
Cysteine (Cys, C)
n = 4 (2.27%)
Valine (Val, V)
n = 16 (9.09%)
Leucine (Leu, L)
n = 22 (12.5%)
Isoleucine (Ile, I)
n = 16 (9.09%)
Methionine (Met, M)
n = 11 (6.25%)
Proline (Pro, P)
n = 4 (2.27%)
Phenylalanine (Phe, F)
n = 11 (6.25%)
Tyrosine (Tyr, Y)
n = 10 (5.68%)
Tryptophan (Trp, W)
n = 7 (3.98%)
Aspartic acid (Asp, D)
n = 5 (2.84%)
Glutamic acid (Glu, E)
n = 8 (4.55%)
Asparagine (Asn, N)
n = 5 (2.84%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 2 (1.14%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 5 3 0 4 1 10 1 1 5 1 4 6 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 2 5 2 5 0 8 6 6 0 3 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 3 0 2 0 6 2 7 3 2 4 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 3 5 0 1 0 1 1 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 16 48 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 28 32 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 24 51 77
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.53%)
Alanine (Ala, A)
n = 252 (6.63%)
Serine (Ser, S)
n = 308 (8.11%)
Threonine (Thr, T)
n = 302 (7.95%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 173 (4.55%)
Leucine (Leu, L)
n = 610 (16.06%)
Isoleucine (Ile, I)
n = 338 (8.9%)
Methionine (Met, M)
n = 239 (6.29%)
Proline (Pro, P)
n = 188 (4.95%)
Phenylalanine (Phe, F)
n = 233 (6.13%)
Tyrosine (Tyr, Y)
n = 140 (3.69%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 154 (4.05%)
Glutamine (Gln, Q)
n = 86 (2.26%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
176 162 194 79 73 201 48 184 76 10 52 30 73 18 98 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 12 16 66 82 97 7 39 55 86 30 54 41 82 11 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 134 17 54 70 120 8 18 38 76 64 27 25 67 87 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 73 23 29 41 84 11 9 13 38 4 1 1 5 3 78
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
801 838 1186 975
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 994 748 1593
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
288 1061 1526 925

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.