Viewing data for Chrysolophus pictus


Scientific name Chrysolophus pictus
Common name Golden pheasant
Maximum lifespan 13.40 years (Chrysolophus pictus@AnAge)

Total mtDNA (size: 16678 bases) GC AT G C A T
Base content (bases) 7473 9205 5206 2267 4129 5076
Base content per 1 kb (bases) 448 552 312 136 248 304
Base content (%) 44.8% 55.2%
Total protein-coding genes (size: 11374 bases) GC AT G C A T
Base content (bases) 5157 6217 3793 1364 2830 3387
Base content per 1 kb (bases) 453 547 333 120 249 298
Base content (%) 45.3% 54.7%
D-loop (size: 1148 bases) GC AT G C A T
Base content (bases) 465 683 301 164 377 306
Base content per 1 kb (bases) 405 595 262 143 328 267
Base content (%) 40.5% 59.5%
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 650 891 388 262 384 507
Base content per 1 kb (bases) 422 578 252 170 249 329
Base content (%) 42.2% 57.8%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1182 1390 704 478 528 862
Base content per 1 kb (bases) 460 540 274 186 205 335
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 968 bases) GC AT G C A T
Base content (bases) 464 504 273 191 195 309
Base content per 1 kb (bases) 479 521 282 197 201 319
Base content (%) 47.9% 52.1%
16S rRNA gene (size: 1604 bases) GC AT G C A T
Base content (bases) 718 886 431 287 333 553
Base content per 1 kb (bases) 448 552 269 179 208 345
Base content (%) 44.8% 55.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 306 378 240 66 185 193
Base content per 1 kb (bases) 447 553 351 96 270 282
Base content (%) 44.7% 55.3%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 64 101 54 10 42 59
Base content per 1 kb (bases) 388 612 327 61 255 358
Base content (%) 38.8% 61.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 697 854 438 259 443 411
Base content per 1 kb (bases) 449 551 282 167 286 265
Base content (%) 44.9% 55.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 303 381 203 100 180 201
Base content per 1 kb (bases) 443 557 297 146 263 294
Base content (%) 44.3% 55.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 369 415 248 121 197 218
Base content per 1 kb (bases) 471 529 316 154 251 278
Base content (%) 47.1% 52.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 533 610 395 138 288 322
Base content per 1 kb (bases) 466 534 346 121 252 282
Base content (%) 46.6% 53.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 456 519 336 120 253 266
Base content per 1 kb (bases) 468 532 345 123 259 273
Base content (%) 46.8% 53.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 436 603 349 87 266 337
Base content per 1 kb (bases) 420 580 336 84 256 324
Base content (%) 42.0% 58.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 161 191 119 42 92 99
Base content per 1 kb (bases) 457 543 338 119 261 281
Base content (%) 45.7% 54.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 624 754 488 136 325 429
Base content per 1 kb (bases) 453 547 354 99 236 311
Base content (%) 45.3% 54.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 108 38 75 76
Base content per 1 kb (bases) 492 508 364 128 253 256
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 824 994 631 193 425 569
Base content per 1 kb (bases) 453 547 347 106 234 313
Base content (%) 45.3% 54.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 243 279 187 56 63 216
Base content per 1 kb (bases) 466 534 358 107 121 414
Base content (%) 46.6% 53.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 8 9 17 22 2 8 8 0 1 2 3 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 6 4 0 1 3 5 0 2 6 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 1 8 4 0 1 3 0 4 2 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 3 0 1 2 2 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 86 68 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 69 34 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 85 91 45
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFTIMILTWFTFSLLIQPKLLSFIPTNSPVNKTATTKPTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 10 (18.52%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 9 (16.67%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.41%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 1 1 0 4 1 0 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 4 3 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 0 0 2 0 0 1 0 0 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 24 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 22 10 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 15 25 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 44 (8.53%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 21 19 15 11 25 3 7 7 2 6 10 14 4 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 10 17 16 1 9 12 19 7 8 10 12 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 0 4 9 12 0 1 2 5 12 2 2 2 13 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 3 9 6 9 0 1 2 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 121 134 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 94 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 177 183 125
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 9 8 10 8 1 4 7 1 3 4 7 2 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 5 5 4 0 1 1 7 0 3 5 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 3 0 4 4 7 1 0 2 1 6 0 0 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 1 6 8 5 0 0 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 62 55 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 81 85 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 7 5 5 18 3 1 5 2 3 6 3 1 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 9 10 0 2 8 8 1 1 4 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 1 3 12 1 2 3 3 6 2 0 0 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 1 3 3 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 71 60 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 107 104 37
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 27 (7.11%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 12 (3.16%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 25 11 9 23 26 0 5 7 1 1 6 9 0 9 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 15 13 0 2 10 11 1 2 8 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 5 0 3 11 12 0 0 1 1 13 1 1 4 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 2 2 4 10 0 0 2 6 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 111 99 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 105 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 179 144 49
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.01%)
Alanine (Ala, A)
n = 28 (8.64%)
Serine (Ser, S)
n = 29 (8.95%)
Threonine (Thr, T)
n = 27 (8.33%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 12 (3.7%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 22 (6.79%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 25 (7.72%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 18 10 4 17 32 4 8 3 2 3 4 3 2 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 21 5 0 2 4 6 1 7 7 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 0 4 11 8 0 1 5 5 7 0 0 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 1 3 6 1 2 1 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 97 86 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 103 53 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 136 127 47
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 24 16 8 20 27 1 7 10 0 1 2 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 8 11 0 1 7 3 1 2 9 9 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 6 10 14 2 2 2 1 4 1 0 3 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 13 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 101 130 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 118 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 130 149 57
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 24 16 8 20 27 1 7 10 0 1 2 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 8 11 0 1 7 3 1 2 9 9 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 6 10 14 2 2 2 1 4 1 0 3 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 13 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 101 130 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 118 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 130 149 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 100 (21.83%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 31 (6.77%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 18 (3.93%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 28 19 11 26 49 5 8 10 1 0 2 4 0 1 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 3 16 14 0 2 6 9 0 4 11 16 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 0 4 12 14 0 2 8 3 10 1 1 2 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 0 2 10 1 2 1 6 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 161 149 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 143 79 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 184 201 59
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 3 2 5 10 0 1 2 0 0 0 2 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 2 4 3 0 0 2 2 0 1 3 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 2 3 4 0 0 3 0 1 1 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 32 23 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 47 36 11
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.12%)
Alanine (Ala, A)
n = 43 (7.11%)
Serine (Ser, S)
n = 43 (7.11%)
Threonine (Thr, T)
n = 78 (12.89%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 105 (17.36%)
Isoleucine (Ile, I)
n = 60 (9.92%)
Methionine (Met, M)
n = 27 (4.46%)
Proline (Pro, P)
n = 33 (5.45%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 10 (1.65%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 15 (2.48%)
Asparagine (Asn, N)
n = 25 (4.13%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 45 24 11 35 46 3 9 17 2 2 3 6 0 12 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 5 5 28 10 0 1 16 12 2 6 14 13 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 31 0 0 16 16 2 2 7 1 9 3 1 6 19 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 13 2 0 7 21 2 1 2 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 169 222 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 188 114 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 274 233 79
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 25 (14.45%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 2 0 2 3 6 0 0 17 0 6 13 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 4 1 5 5 4 2 4 15 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 9 0 0 1 2 0 6 3 2 12 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 5 0 0 1 1 0 1 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 16 15 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 31 19 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 9 29 72
Total protein-coding genes (size: 11391 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.67%)
Alanine (Ala, A)
n = 283 (7.46%)
Serine (Ser, S)
n = 295 (7.77%)
Threonine (Thr, T)
n = 352 (9.28%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 161 (4.24%)
Leucine (Leu, L)
n = 656 (17.29%)
Isoleucine (Ile, I)
n = 303 (7.98%)
Methionine (Met, M)
n = 170 (4.48%)
Proline (Pro, P)
n = 233 (6.14%)
Phenylalanine (Phe, F)
n = 229 (6.03%)
Tyrosine (Tyr, Y)
n = 103 (2.71%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 129 (3.4%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 89 (2.35%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
89 214 132 88 179 279 26 67 82 11 37 39 63 22 77 152
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 10 19 45 134 98 6 25 73 88 29 43 83 100 7 76
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
143 133 0 38 89 109 8 13 38 26 77 16 17 23 106 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 82 12 26 37 84 5 9 13 42 7 0 1 7 2 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 1080 1095 805
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
474 1112 691 1519
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
207 1472 1457 660

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.