Viewing data for Uncia uncia


Scientific name Uncia uncia
Common name Snow leopard
Maximum lifespan 21.20 years (Uncia uncia@AnAge)

Total mtDNA (size: 16773 bases) GC AT G C A T
Base content (bases) 6872 9901 4444 2428 4544 5357
Base content per 1 kb (bases) 410 590 265 145 271 319
Base content (%) 41.0% 59.0%
Total protein-coding genes (size: 11314 bases) GC AT G C A T
Base content (bases) 4711 6603 3191 1520 3131 3472
Base content per 1 kb (bases) 416 584 282 134 277 307
Base content (%) 41.6% 58.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 558 954 318 240 430 524
Base content per 1 kb (bases) 369 631 210 159 284 347
Base content (%) 36.9% 63.1%
Total rRNA-coding genes (size: 2540 bases) GC AT G C A T
Base content (bases) 1032 1508 569 463 590 918
Base content per 1 kb (bases) 406 594 224 182 232 361
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 402 558 231 171 213 345
Base content per 1 kb (bases) 419 581 241 178 222 359
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1580 bases) GC AT G C A T
Base content (bases) 630 950 338 292 377 573
Base content per 1 kb (bases) 399 601 214 185 239 363
Base content (%) 39.9% 60.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 281 400 196 85 199 201
Base content per 1 kb (bases) 413 587 288 125 292 295
Base content (%) 41.3% 58.7%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 69 135 52 17 56 79
Base content per 1 kb (bases) 338 662 255 83 275 387
Base content (%) 33.8% 66.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 648 897 354 294 495 402
Base content per 1 kb (bases) 419 581 229 190 320 260
Base content (%) 41.9% 58.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 280 404 180 100 186 218
Base content per 1 kb (bases) 409 591 263 146 272 319
Base content (%) 40.9% 59.1%
COX3 (size: 759 bases) GC AT G C A T
Base content (bases) 333 426 214 119 213 213
Base content per 1 kb (bases) 439 561 282 157 281 281
Base content (%) 43.9% 56.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 520 620 355 165 304 316
Base content per 1 kb (bases) 456 544 311 145 267 277
Base content (%) 45.6% 54.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 423 533 304 119 248 285
Base content per 1 kb (bases) 442 558 318 124 259 298
Base content (%) 44.2% 55.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 400 642 303 97 263 379
Base content per 1 kb (bases) 384 616 291 93 252 364
Base content (%) 38.4% 61.6%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 144 203 103 41 94 109
Base content per 1 kb (bases) 415 585 297 118 271 314
Base content (%) 41.5% 58.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 568 810 395 173 379 431
Base content per 1 kb (bases) 412 588 287 126 275 313
Base content (%) 41.2% 58.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 73 42 95 87
Base content per 1 kb (bases) 387 613 246 141 320 293
Base content (%) 38.7% 61.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 742 1079 522 220 511 568
Base content per 1 kb (bases) 407 593 287 121 281 312
Base content (%) 40.7% 59.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 210 318 157 53 107 211
Base content per 1 kb (bases) 398 602 297 100 203 400
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 8 4 4 21 6 8 6 3 0 3 7 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 8 9 3 0 1 2 7 1 3 6 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 1 2 2 6 0 1 2 1 1 1 0 7 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 1 4 0 0 3 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 69 76 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 63 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 64 86 60
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITITSMIMTLFIMFQLKISKHLYPSSPELKSTAALKQPSPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 3 1 1 4 1 1 4 1 0 0 0 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 3 1 2 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 2 1 1 5 0 1 1 2 0 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 26 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 19 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 9 34 18
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 40 (7.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.78%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 33 (6.42%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 20 6 7 19 10 15 3 3 4 11 17 8 25 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 1 0 17 8 15 1 8 11 14 13 11 9 5 3 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 1 5 6 14 2 3 0 11 8 6 4 13 4 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 2 8 7 8 1 1 1 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 102 135 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 136 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 116 172 160
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 11 3 5 12 6 8 6 1 2 3 5 1 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 1 5 1 0 3 3 2 1 4 4 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 2 3 5 7 0 2 2 6 5 0 0 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 12 4 4 6 2 2 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 59 67 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 67 89 51
COX3 (size: 759 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.94%)
Alanine (Ala, A)
n = 17 (6.75%)
Serine (Ser, S)
n = 18 (7.14%)
Threonine (Thr, T)
n = 23 (9.13%)
Cysteine (Cys, C)
n = 3 (1.19%)
Valine (Val, V)
n = 12 (4.76%)
Leucine (Leu, L)
n = 35 (13.89%)
Isoleucine (Ile, I)
n = 12 (4.76%)
Methionine (Met, M)
n = 13 (5.16%)
Proline (Pro, P)
n = 10 (3.97%)
Phenylalanine (Phe, F)
n = 20 (7.94%)
Tyrosine (Tyr, Y)
n = 11 (4.37%)
Tryptophan (Trp, W)
n = 10 (3.97%)
Aspartic acid (Asp, D)
n = 2 (0.79%)
Glutamic acid (Glu, E)
n = 7 (2.78%)
Asparagine (Asn, N)
n = 7 (2.78%)
Glutamine (Gln, Q)
n = 7 (2.78%)
Histidine (His, H)
n = 17 (6.75%)
Lysine (Lys, K)
n = 4 (1.59%)
Arginine (Arg, R)
n = 4 (1.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 9 4 7 14 3 5 7 0 2 3 5 2 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 6 6 5 0 6 2 8 4 1 4 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 1 2 4 8 0 0 4 4 7 3 2 1 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 1 1 4 0 1 0 2 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 66 63 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 64 56 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 84 94 55
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 30 (7.92%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 27 7 9 9 28 3 7 4 2 0 8 9 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 3 2 12 7 0 0 10 11 5 6 9 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 4 9 14 1 0 2 5 10 2 2 5 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 3 8 8 1 0 2 6 1 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 99 105 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 95 77 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 161 134 57
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 20 (6.31%)
Threonine (Thr, T)
n = 27 (8.52%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 20 16 5 12 29 4 3 6 0 2 3 8 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 5 14 10 0 0 4 6 2 3 10 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 2 8 6 0 2 2 5 8 2 1 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 0 3 5 2 0 2 6 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 89 98 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 94 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 121 132 48
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 37 3 8 31 4 6 7 2 2 4 3 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 3 8 8 1 0 6 7 1 5 9 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 3 8 12 1 0 2 3 7 0 0 5 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 15 0 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 85 148 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 116 171 46
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 37 3 8 31 4 6 7 2 2 4 3 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 3 8 8 1 0 6 7 1 5 9 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 3 8 12 1 0 2 3 7 0 0 5 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 15 0 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 85 148 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 116 171 46
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 43 (9.39%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 20 (4.37%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 25 11 20 37 11 11 9 2 1 5 12 2 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 7 16 10 1 3 5 8 1 8 7 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 3 3 7 16 0 4 6 11 6 4 2 6 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 3 0 4 13 0 2 1 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 130 160 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 124 83 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 141 188 94
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 8 1 2 9 5 3 2 0 0 1 5 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 2 1 3 1 1 2 1 0 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 5 2 0 0 1 3 1 0 1 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 31 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 29 38 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 40 (6.6%)
Serine (Ser, S)
n = 53 (8.75%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 22 (3.63%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 36 (5.94%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 32 (5.28%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 17 (2.81%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 38 34 9 22 34 5 14 16 4 6 5 9 2 19 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 7 17 14 2 4 6 14 4 4 10 11 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 17 4 8 15 12 5 5 8 10 9 0 4 15 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 4 4 6 19 5 1 3 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 142 213 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 159 135 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 221 220 124
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 11 (6.29%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 3 2 0 1 0 8 0 0 5 1 5 10 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 3 3 3 3 13 1 3 7 3 1 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 3 1 1 2 4 1 8 1 3 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 8 46 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 34 31 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 11 30 84
Total protein-coding genes (size: 11382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.64%)
Alanine (Ala, A)
n = 261 (6.88%)
Serine (Ser, S)
n = 283 (7.47%)
Threonine (Thr, T)
n = 319 (8.41%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 186 (4.91%)
Leucine (Leu, L)
n = 591 (15.59%)
Isoleucine (Ile, I)
n = 324 (8.55%)
Methionine (Met, M)
n = 245 (6.46%)
Proline (Pro, P)
n = 195 (5.14%)
Phenylalanine (Phe, F)
n = 227 (5.99%)
Tyrosine (Tyr, Y)
n = 135 (3.56%)
Tryptophan (Trp, W)
n = 102 (2.69%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 99 (2.61%)
Asparagine (Asn, N)
n = 150 (3.96%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 98 (2.59%)
Lysine (Lys, K)
n = 104 (2.74%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
148 176 187 62 99 255 59 93 73 18 24 47 88 27 101 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
58 11 14 62 105 84 10 39 52 84 39 54 75 58 8 77
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
101 123 18 39 73 105 11 22 33 71 64 22 23 61 89 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 70 29 28 38 90 14 6 15 45 2 1 0 8 0 80
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
826 927 1198 841
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 1003 751 1573
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
338 1174 1444 836

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.