Viewing data for Artibeus jamaicensis


Scientific name Artibeus jamaicensis
Common name Jamaican fruit-eating bat
Maximum lifespan 19.20 years (Artibeus jamaicensis@AnAge)

Total mtDNA (size: 16651 bases) GC AT G C A T
Base content (bases) 6305 10346 4118 2187 4942 5404
Base content per 1 kb (bases) 379 621 247 131 297 325
Base content (%) 37.9% 62.1%
Total protein-coding genes (size: 11347 bases) GC AT G C A T
Base content (bases) 4217 7130 2932 1285 3545 3585
Base content per 1 kb (bases) 372 628 258 113 312 316
Base content (%) 37.2% 62.8%
D-loop (size: 1228 bases) GC AT G C A T
Base content (bases) 523 705 318 205 324 381
Base content per 1 kb (bases) 426 574 259 167 264 310
Base content (%) 42.6% 57.4%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 547 964 308 239 432 532
Base content per 1 kb (bases) 362 638 204 158 286 352
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2524 bases) GC AT G C A T
Base content (bases) 995 1529 546 449 632 897
Base content per 1 kb (bases) 394 606 216 178 250 355
Base content (%) 39.4% 60.6%
12S rRNA gene (size: 965 bases) GC AT G C A T
Base content (bases) 411 554 230 181 231 323
Base content per 1 kb (bases) 426 574 238 188 239 335
Base content (%) 42.6% 57.4%
16S rRNA gene (size: 1559 bases) GC AT G C A T
Base content (bases) 584 975 316 268 401 574
Base content per 1 kb (bases) 375 625 203 172 257 368
Base content (%) 37.5% 62.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 245 436 173 72 224 212
Base content per 1 kb (bases) 360 640 254 106 329 311
Base content (%) 36.0% 64.0%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 56 148 44 12 69 79
Base content per 1 kb (bases) 275 725 216 59 338 387
Base content (%) 27.5% 72.5%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 602 943 359 243 512 431
Base content per 1 kb (bases) 390 610 232 157 331 279
Base content (%) 39.0% 61.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 255 429 165 90 206 223
Base content per 1 kb (bases) 373 627 241 132 301 326
Base content (%) 37.3% 62.7%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 313 472 203 110 257 215
Base content per 1 kb (bases) 399 601 259 140 327 274
Base content (%) 39.9% 60.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 453 687 306 147 356 331
Base content per 1 kb (bases) 397 603 268 129 312 290
Base content (%) 39.7% 60.3%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 381 576 268 113 277 299
Base content per 1 kb (bases) 398 602 280 118 289 312
Base content (%) 39.8% 60.2%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 355 692 274 81 311 381
Base content per 1 kb (bases) 339 661 262 77 297 364
Base content (%) 33.9% 66.1%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 125 223 87 38 111 112
Base content per 1 kb (bases) 359 641 250 109 319 322
Base content (%) 35.9% 64.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 500 878 363 137 442 436
Base content per 1 kb (bases) 363 637 263 99 321 316
Base content (%) 36.3% 63.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 90 207 62 28 111 96
Base content per 1 kb (bases) 303 697 209 94 374 323
Base content (%) 30.3% 69.7%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 678 1143 491 187 571 572
Base content per 1 kb (bases) 372 628 270 103 314 314
Base content (%) 37.2% 62.8%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 155 34 118 221
Base content per 1 kb (bases) 358 642 294 64 223 419
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 11 (4.87%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 11 13 3 4 21 1 14 8 0 4 2 3 1 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 10 6 3 0 3 5 3 0 3 3 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 1 5 1 2 0 2 1 1 2 0 0 9 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 1 0 4 0 1 0 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 61 80 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 38 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 51 94 77
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILATILTLFIIMQLKISTYYYHSNPEPKTTKMTKSLIPWEIKWTKIYSPLSLPLR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 10 (14.93%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 9 (13.43%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 4 (5.97%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 2 (2.99%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 1 1 0 3 0 5 2 0 0 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 1 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 2 1 2 1 0 0 3 1 0 0 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 0 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 14 29 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 23 18 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 7 32 25
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.78%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 29 (5.64%)
Proline (Pro, P)
n = 29 (5.64%)
Phenylalanine (Phe, F)
n = 43 (8.37%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 9 27 11 8 24 3 14 5 1 10 8 22 0 21 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 18 11 13 0 13 10 21 3 12 6 11 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 20 1 11 7 9 0 2 1 12 7 2 0 13 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 0 7 7 8 1 3 1 5 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 108 132 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 115 205 182
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 11 (4.85%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 5 14 8 3 14 0 7 5 1 3 0 8 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 2 4 0 1 5 1 1 3 3 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 1 7 3 6 1 1 3 6 5 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 5 9 3 4 1 1 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 56 70 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 51 93 72
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 7 7 5 5 1 17 7 0 3 4 8 0 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 4 3 0 2 7 10 2 1 4 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 0 3 9 6 0 1 2 7 5 0 1 2 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 3 1 3 0 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 57 58 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 81 100 74
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 18 (4.75%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 12 14 15 11 21 0 12 7 0 2 10 12 0 13 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 10 6 7 0 2 8 15 0 3 8 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 8 4 8 0 1 4 14 4 0 1 5 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 2 9 7 1 0 2 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 98 101 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 92 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 116 154 106
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 28 (8.81%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 27 (8.49%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 16 (5.03%)
Tyrosine (Tyr, Y)
n = 16 (5.03%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 12 17 4 9 27 2 13 6 0 2 3 9 0 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 13 7 1 3 4 6 0 6 7 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 1 7 4 6 0 1 2 8 8 0 0 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 2 1 5 2 0 3 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 81 96 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 95 59 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 92 144 73
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.02%)
Alanine (Ala, A)
n = 20 (5.75%)
Serine (Ser, S)
n = 26 (7.47%)
Threonine (Thr, T)
n = 48 (13.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 59 (16.95%)
Isoleucine (Ile, I)
n = 38 (10.92%)
Methionine (Met, M)
n = 35 (10.06%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 10 (2.87%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.89%)
Glutamine (Gln, Q)
n = 7 (2.01%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.16%)
Arginine (Arg, R)
n = 2 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 34 8 12 23 1 15 6 1 2 2 5 0 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 6 10 0 2 3 9 0 1 7 12 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 5 7 12 0 0 2 7 3 0 0 9 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 0 1 0 11 0 1 0 1 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 78 151 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 112 57 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 84 173 88
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.02%)
Alanine (Ala, A)
n = 20 (5.75%)
Serine (Ser, S)
n = 26 (7.47%)
Threonine (Thr, T)
n = 48 (13.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 59 (16.95%)
Isoleucine (Ile, I)
n = 38 (10.92%)
Methionine (Met, M)
n = 35 (10.06%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 10 (2.87%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.89%)
Glutamine (Gln, Q)
n = 7 (2.01%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.16%)
Arginine (Arg, R)
n = 2 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 34 8 12 23 1 15 6 1 2 2 5 0 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 6 10 0 2 3 9 0 1 7 12 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 5 7 12 0 0 2 7 3 0 0 9 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 0 1 0 11 0 1 0 1 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 78 151 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 112 57 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 84 173 88
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 17 31 16 13 40 2 23 10 1 4 2 5 1 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 7 11 14 0 5 6 6 0 5 12 6 0 20
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 0 8 10 8 0 2 7 11 3 0 0 11 9 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 1 2 3 8 2 1 2 7 0 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 127 161 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 123 80 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 113 195 141
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 14 (14.29%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 13 4 3 8 0 8 2 0 0 0 5 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 1 1 4 0 2 1 1 0 0 1 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 3 3 2 0 1 0 2 2 0 0 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 21 32 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 16 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 18 48 32
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 37 (6.11%)
Serine (Ser, S)
n = 49 (8.09%)
Threonine (Thr, T)
n = 55 (9.08%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 105 (17.33%)
Isoleucine (Ile, I)
n = 56 (9.24%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 30 (4.95%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 30 (4.95%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 24 35 20 21 42 2 19 14 3 2 4 10 1 26 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 11 16 10 0 2 8 14 4 10 9 11 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 19 1 9 11 17 1 6 5 6 10 0 1 19 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 6 3 20 2 3 1 6 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 155 213 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 160 119 263
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 176 240 171
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 16 (9.14%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 28 (16.0%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 12 (6.86%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 2 (1.14%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 1 5 0 0 1 0 8 0 0 14 0 8 6 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 0 2 0 11 0 5 10 3 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 5 0 3 0 8 0 7 0 0 10 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 2 0 0 5 1 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 6 47 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 27 27 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 1 44 87
Total protein-coding genes (size: 11415 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 246 (6.47%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 335 (8.81%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 188 (4.94%)
Leucine (Leu, L)
n = 621 (16.33%)
Isoleucine (Ile, I)
n = 325 (8.55%)
Methionine (Met, M)
n = 244 (6.42%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 227 (5.97%)
Tyrosine (Tyr, Y)
n = 137 (3.6%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 148 (3.89%)
Glutamine (Gln, Q)
n = 83 (2.18%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
212 113 218 101 96 237 12 162 76 7 46 35 98 9 133 94
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 13 11 84 80 81 1 46 58 93 20 50 66 83 1 106
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
78 144 7 76 62 83 3 27 28 87 50 3 13 84 64 44
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
53 76 16 38 28 78 14 12 15 38 2 1 0 9 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 893 1200 902
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
469 1005 725 1605
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
135 931 1579 1159

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.