Viewing data for Anguis fragilis


Scientific name Anguis fragilis
Common name Slow worm
Maximum lifespan 54.00 years (Anguis fragilis@AnAge)

Total mtDNA (size: 17479 bases) GC AT G C A T
Base content (bases) 7840 9639 4937 2903 4537 5102
Base content per 1 kb (bases) 449 551 282 166 260 292
Base content (%) 44.9% 55.1%
Total protein-coding genes (size: 11377 bases) GC AT G C A T
Base content (bases) 5212 6165 3526 1686 2982 3183
Base content per 1 kb (bases) 458 542 310 148 262 280
Base content (%) 45.8% 54.2%
D-loop (size: 1164 bases) GC AT G C A T
Base content (bases) 477 687 176 301 352 335
Base content per 1 kb (bases) 410 590 151 259 302 288
Base content (%) 41.0% 59.0%
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 620 918 352 268 401 517
Base content per 1 kb (bases) 403 597 229 174 261 336
Base content (%) 40.3% 59.7%
Total rRNA-coding genes (size: 2492 bases) GC AT G C A T
Base content (bases) 1117 1375 683 434 499 876
Base content per 1 kb (bases) 448 552 274 174 200 352
Base content (%) 44.8% 55.2%
12S rRNA gene (size: 941 bases) GC AT G C A T
Base content (bases) 426 515 265 161 181 334
Base content per 1 kb (bases) 453 547 282 171 192 355
Base content (%) 45.3% 54.7%
16S rRNA gene (size: 1551 bases) GC AT G C A T
Base content (bases) 691 860 418 273 318 542
Base content per 1 kb (bases) 446 554 270 176 205 349
Base content (%) 44.6% 55.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 229 76 180 199
Base content per 1 kb (bases) 446 554 335 111 263 291
Base content (%) 44.6% 55.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 68 100 52 16 43 57
Base content per 1 kb (bases) 405 595 310 95 256 339
Base content (%) 40.5% 59.5%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 738 807 455 283 424 383
Base content per 1 kb (bases) 478 522 294 183 274 248
Base content (%) 47.8% 52.2%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 316 372 209 107 163 209
Base content per 1 kb (bases) 459 541 304 156 237 304
Base content (%) 45.9% 54.1%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 380 405 244 136 195 210
Base content per 1 kb (bases) 484 516 311 173 248 268
Base content (%) 48.4% 51.6%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 513 624 356 157 305 319
Base content per 1 kb (bases) 451 549 313 138 268 281
Base content (%) 45.1% 54.9%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 464 511 317 147 250 261
Base content per 1 kb (bases) 476 524 325 151 256 268
Base content (%) 47.6% 52.4%
ND2 (size: 1035 bases) GC AT G C A T
Base content (bases) 477 558 353 124 231 327
Base content per 1 kb (bases) 461 539 341 120 223 316
Base content (%) 46.1% 53.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 162 184 113 49 94 90
Base content per 1 kb (bases) 468 532 327 142 272 260
Base content (%) 46.8% 53.2%
ND4 (size: 1382 bases) GC AT G C A T
Base content (bases) 634 748 466 168 349 399
Base content per 1 kb (bases) 459 541 337 122 253 289
Base content (%) 45.9% 54.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 132 165 94 38 90 75
Base content per 1 kb (bases) 444 556 316 128 303 253
Base content (%) 44.4% 55.6%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 800 1024 577 223 443 581
Base content per 1 kb (bases) 439 561 316 122 243 319
Base content (%) 43.9% 56.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 227 295 64 163 217 78
Base content per 1 kb (bases) 435 565 123 312 416 149
Base content (%) 43.5% 56.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 27 (11.89%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 14 8 8 12 24 9 3 7 3 2 2 3 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 8 5 0 1 2 5 1 2 3 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 6 0 1 4 1 1 0 3 2 2 0 3 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 1 0 4 0 0 2 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 86 80 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 63 36 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 80 83 43
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLLILALSWLTLTTLFLTKTQNARFHNSPVQHQTNKQETSTWLWPWP*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 10 (18.18%)
Isoleucine (Ile, I)
n = 1 (1.82%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 5 (9.09%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 4 1 0 1 3 5 0 0 0 1 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 1 0 0 0 0 0 0 3 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 0 1 1 0 0 1 0 0 0 1 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 0 1 1 0 1 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 20 18 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 18 16 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 14 23 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.34%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 33 (6.42%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 57 (11.09%)
Isoleucine (Ile, I)
n = 42 (8.17%)
Methionine (Met, M)
n = 27 (5.25%)
Proline (Pro, P)
n = 27 (5.25%)
Phenylalanine (Phe, F)
n = 39 (7.59%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.89%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 22 19 13 12 20 10 2 5 2 9 13 12 5 18 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 1 8 20 11 3 4 13 21 10 5 15 5 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 11 1 6 10 11 1 0 5 5 15 4 0 2 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 3 5 10 9 1 0 3 5 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 117 136 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 135 96 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 203 151 111
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 12 (5.26%)
Serine (Ser, S)
n = 19 (8.33%)
Threonine (Thr, T)
n = 20 (8.77%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.7%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 21 (9.21%)
Methionine (Met, M)
n = 12 (5.26%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 10 (4.39%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 10 7 2 5 11 5 3 7 2 1 5 5 2 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 2 4 6 0 1 5 2 1 2 6 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 1 7 7 0 1 3 4 6 3 0 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 5 3 8 4 1 0 2 3 0 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 58 68 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 92 79 34
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 7 2 10 14 5 0 9 1 1 8 6 2 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 11 7 0 1 11 8 1 2 4 5 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 2 2 2 5 1 0 3 5 6 1 2 0 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 3 2 1 1 1 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 75 56 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 65 59 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 104 94 39
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.61%)
Alanine (Ala, A)
n = 29 (7.67%)
Serine (Ser, S)
n = 25 (6.61%)
Threonine (Thr, T)
n = 26 (6.88%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 10 (2.65%)
Leucine (Leu, L)
n = 61 (16.14%)
Isoleucine (Ile, I)
n = 37 (9.79%)
Methionine (Met, M)
n = 14 (3.7%)
Proline (Pro, P)
n = 24 (6.35%)
Phenylalanine (Phe, F)
n = 27 (7.14%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 17 (4.5%)
Glutamine (Gln, Q)
n = 10 (2.65%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.91%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 10 13 12 24 4 8 8 2 2 2 5 1 10 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 7 13 9 0 1 6 10 8 1 7 10 6 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 3 10 11 0 0 1 4 11 3 0 4 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 1 6 9 2 0 2 6 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 107 106 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 146 135 66
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 26 (8.02%)
Serine (Ser, S)
n = 25 (7.72%)
Threonine (Thr, T)
n = 14 (4.32%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 17 (5.25%)
Proline (Pro, P)
n = 25 (7.72%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 9 (2.78%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 10 (3.09%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 8 (2.47%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 13 12 14 24 5 4 9 1 3 6 7 2 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 13 11 0 0 7 4 6 3 7 11 4 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 4 0 3 9 8 2 0 3 3 8 2 3 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 1 2 8 0 1 4 3 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 102 79 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 87 61 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 128 121 43
ND2 (size: 1035 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.65%)
Alanine (Ala, A)
n = 30 (8.72%)
Serine (Ser, S)
n = 37 (10.76%)
Threonine (Thr, T)
n = 40 (11.63%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 71 (20.64%)
Isoleucine (Ile, I)
n = 25 (7.27%)
Methionine (Met, M)
n = 22 (6.4%)
Proline (Pro, P)
n = 23 (6.69%)
Phenylalanine (Phe, F)
n = 10 (2.91%)
Tyrosine (Tyr, Y)
n = 4 (1.16%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 8 (2.33%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 14 (4.07%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 16 11 10 36 8 4 11 1 0 1 4 1 0 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 18 11 0 0 3 9 4 3 10 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 12 15 0 0 7 0 4 0 2 1 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 2 10 4 0 0 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 109 116 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 123 52 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 121 159 37
ND3 (size: 1035 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.65%)
Alanine (Ala, A)
n = 30 (8.72%)
Serine (Ser, S)
n = 37 (10.76%)
Threonine (Thr, T)
n = 40 (11.63%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 71 (20.64%)
Isoleucine (Ile, I)
n = 25 (7.27%)
Methionine (Met, M)
n = 22 (6.4%)
Proline (Pro, P)
n = 23 (6.69%)
Phenylalanine (Phe, F)
n = 10 (2.91%)
Tyrosine (Tyr, Y)
n = 4 (1.16%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 8 (2.33%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 14 (4.07%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 16 11 10 36 8 4 11 1 0 1 4 1 0 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 18 11 0 0 3 9 4 3 10 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 12 15 0 0 7 0 4 0 2 1 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 2 10 4 0 0 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 109 116 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 123 52 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 121 159 37
ND4 (size: 1382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.92%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 38 (8.28%)
Threonine (Thr, T)
n = 42 (9.15%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 13 (2.83%)
Leucine (Leu, L)
n = 105 (22.88%)
Isoleucine (Ile, I)
n = 37 (8.06%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 15 (3.27%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 15 20 21 50 8 6 9 1 1 6 6 0 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 5 1 18 14 0 0 8 8 2 2 10 10 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 18 2 3 14 10 1 0 10 6 9 3 0 7 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 1 2 9 2 0 4 8 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 161 140 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 128 80 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 177 179 71
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 5 4 6 2 8 2 0 2 0 2 0 0 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 3 5 2 0 1 1 3 0 0 1 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 1 3 1 2 0 1 0 0 0 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 31 28 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 29 16 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 34 31 27
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.78%)
Alanine (Ala, A)
n = 48 (7.91%)
Serine (Ser, S)
n = 44 (7.25%)
Threonine (Thr, T)
n = 76 (12.52%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 100 (16.47%)
Isoleucine (Ile, I)
n = 56 (9.23%)
Methionine (Met, M)
n = 30 (4.94%)
Proline (Pro, P)
n = 35 (5.77%)
Phenylalanine (Phe, F)
n = 33 (5.44%)
Tyrosine (Tyr, Y)
n = 8 (1.32%)
Tryptophan (Trp, W)
n = 11 (1.81%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 26 (4.28%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 24 (3.95%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 34 24 19 22 35 8 13 17 2 2 3 11 2 12 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 6 6 24 15 3 3 11 14 1 5 10 16 4 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 39 2 4 12 16 2 3 7 3 5 2 3 7 19 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 1 9 21 3 0 1 7 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 161 222 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 193 113 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 223 246 97
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 15 (8.67%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 7 (4.05%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 1 1 2 0 4 2 13 0 0 12 2 4 8 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 3 0 3 4 5 2 3 15 2 2 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 5 0 3 3 4 0 8 1 2 9 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 4 2 1 0 0 4 0 0 1 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 19 23 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 19 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 15 36 71
Total protein-coding genes (size: 11388 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 227 (5.98%)
Alanine (Ala, A)
n = 286 (7.54%)
Serine (Ser, S)
n = 278 (7.33%)
Threonine (Thr, T)
n = 333 (8.78%)
Cysteine (Cys, C)
n = 32 (0.84%)
Valine (Val, V)
n = 174 (4.59%)
Leucine (Leu, L)
n = 655 (17.27%)
Isoleucine (Ile, I)
n = 308 (8.12%)
Methionine (Met, M)
n = 181 (4.77%)
Proline (Pro, P)
n = 223 (5.88%)
Phenylalanine (Phe, F)
n = 215 (5.67%)
Tyrosine (Tyr, Y)
n = 111 (2.93%)
Tryptophan (Trp, W)
n = 102 (2.69%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 129 (3.4%)
Glutamine (Gln, Q)
n = 106 (2.79%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 92 (2.43%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
128 180 126 116 123 264 67 61 91 15 35 49 66 24 92 123
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 7 25 39 141 96 10 17 72 89 49 31 78 87 27 38
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
147 140 8 33 87 92 13 8 45 40 71 21 24 32 97 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
80 64 26 18 43 77 15 6 20 43 4 1 0 6 2 81
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
838 1081 1097 778
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1067 706 1533
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
360 1381 1384 669

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.