Viewing data for Sylvicapra grimmia


Scientific name Sylvicapra grimmia
Common name Bush duiker
Maximum lifespan 15.40 years (Sylvicapra grimmia@AnAge)

Total mtDNA (size: 16437 bases) GC AT G C A T
Base content (bases) 6562 9875 4375 2187 4383 5492
Base content per 1 kb (bases) 399 601 266 133 267 334
Base content (%) 39.9% 60.1%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4573 6765 3221 1352 3078 3687
Base content per 1 kb (bases) 403 597 284 119 271 325
Base content (%) 40.3% 59.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 554 961 321 233 429 532
Base content per 1 kb (bases) 366 634 212 154 283 351
Base content (%) 36.6% 63.4%
Total rRNA-coding genes (size: 2529 bases) GC AT G C A T
Base content (bases) 1005 1524 570 435 574 950
Base content per 1 kb (bases) 397 603 225 172 227 376
Base content (%) 39.7% 60.3%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 394 559 224 170 210 349
Base content per 1 kb (bases) 413 587 235 178 220 366
Base content (%) 41.3% 58.7%
16S rRNA gene (size: 1576 bases) GC AT G C A T
Base content (bases) 611 965 346 265 364 601
Base content per 1 kb (bases) 388 612 220 168 231 381
Base content (%) 38.8% 61.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 283 398 205 78 182 216
Base content per 1 kb (bases) 416 584 301 115 267 317
Base content (%) 41.6% 58.4%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 66 141 51 15 59 82
Base content per 1 kb (bases) 319 681 246 72 285 396
Base content (%) 31.9% 68.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 631 914 388 243 464 450
Base content per 1 kb (bases) 408 592 251 157 300 291
Base content (%) 40.8% 59.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 173 88 170 253
Base content per 1 kb (bases) 382 618 253 129 249 370
Base content (%) 38.2% 61.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 361 423 243 118 214 209
Base content per 1 kb (bases) 460 540 310 151 273 267
Base content (%) 46.0% 54.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 489 651 341 148 293 358
Base content per 1 kb (bases) 429 571 299 130 257 314
Base content (%) 42.9% 57.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 385 571 270 115 273 298
Base content per 1 kb (bases) 403 597 282 120 286 312
Base content (%) 40.3% 59.7%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 389 653 301 88 268 385
Base content per 1 kb (bases) 373 627 289 84 257 369
Base content (%) 37.3% 62.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 148 198 107 41 92 106
Base content per 1 kb (bases) 428 572 309 118 266 306
Base content (%) 42.8% 57.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 547 831 401 146 382 449
Base content per 1 kb (bases) 397 603 291 106 277 326
Base content (%) 39.7% 60.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 74 37 93 93
Base content per 1 kb (bases) 374 626 249 125 313 313
Base content (%) 37.4% 62.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 737 1084 534 203 494 590
Base content per 1 kb (bases) 405 595 293 111 271 324
Base content (%) 40.5% 59.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 148 41 118 221
Base content per 1 kb (bases) 358 642 280 78 223 419
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 6 9 4 9 26 1 6 9 0 4 5 3 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 9 4 0 0 4 6 1 2 4 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 0 1 2 4 2 1 5 1 1 1 0 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 1 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 72 78 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 71 101 45
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLALFIIFQLKISKHNFYLNPELMSMKASKQNTPWETKWTKIYLPLSLPLWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.94%)
Serine (Ser, S)
n = 6 (8.82%)
Threonine (Thr, T)
n = 6 (8.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (17.65%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 5 (7.35%)
Proline (Pro, P)
n = 5 (7.35%)
Phenylalanine (Phe, F)
n = 4 (5.88%)
Tyrosine (Tyr, Y)
n = 3 (4.41%)
Tryptophan (Trp, W)
n = 4 (5.88%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 2 (2.94%)
Asparagine (Asn, N)
n = 3 (4.41%)
Glutamine (Gln, Q)
n = 3 (4.41%)
Histidine (His, H)
n = 1 (1.47%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 3 1 4 1 1 3 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 2 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 0 0 6 0 0 0 1 2 0 2 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 0 0 0 0 0 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 25 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 20 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 14 37 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 29 13 3 28 5 11 5 1 6 5 25 1 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 10 12 16 1 9 10 26 2 14 6 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 11 5 11 0 1 2 11 8 2 0 4 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 5 10 8 1 2 0 6 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 108 142 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 147 213 135
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 14 2 3 22 2 4 5 1 1 2 8 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 0 2 4 2 0 3 5 0 2 3 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 15 0 4 4 8 0 2 3 6 5 0 1 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 1 3 7 5 1 1 0 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 61 69 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 57 123 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 9 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 11 5 6 7 12 1 6 6 1 2 8 7 0 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 9 4 0 5 7 8 0 3 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 1 1 5 9 0 0 4 3 8 1 1 3 6 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 1 2 2 0 0 3 1 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 66 60 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 111 93 46
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 11 7 14 32 1 3 5 1 2 7 7 1 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 1 10 16 0 4 5 13 2 2 4 16 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 3 5 10 1 1 2 7 9 0 0 4 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 2 9 9 0 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 102 114 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 143 166 60
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 13 13 6 8 28 3 11 7 0 3 3 8 1 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 5 7 15 1 2 5 4 1 4 9 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 3 6 10 0 1 3 4 8 0 0 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 7 0 1 0 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 85 91 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 90 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 95 151 60
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 24 40 4 10 31 2 8 10 0 4 3 5 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 7 9 0 0 5 8 1 2 8 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 2 11 13 0 1 1 3 5 1 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 2 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 84 147 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 117 180 41
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 24 40 4 10 31 2 8 10 0 4 3 5 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 7 9 0 0 5 8 1 2 8 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 2 11 13 0 1 1 3 5 1 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 2 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 84 147 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 117 180 41
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 26 (5.68%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 20 27 10 16 55 1 10 11 0 1 7 8 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 3 11 13 1 3 6 7 2 5 6 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 24 1 9 13 6 1 1 9 3 13 1 3 11 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 2 0 3 11 0 1 2 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 133 158 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 112 85 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 156 206 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 10 2 1 11 1 6 2 0 0 2 6 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 2 5 0 1 1 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 1 6 1 1 0 1 1 2 0 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 21 27 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 16 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 30 50 14
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 52 (8.58%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 63 (10.4%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 32 35 7 22 39 7 13 16 1 4 5 3 2 16 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 3 13 19 4 2 11 13 2 5 11 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 28 5 5 20 12 0 3 12 11 9 2 1 9 25 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 4 6 19 2 0 4 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 140 231 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 161 126 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 233 233 108
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 6 0 0 1 1 8 1 0 7 2 6 7 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 5 0 0 2 13 0 4 9 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 5 0 2 0 4 0 8 2 3 8 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 7 48 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 8 37 87
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 246 (6.47%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 314 (8.26%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 187 (4.92%)
Leucine (Leu, L)
n = 604 (15.89%)
Isoleucine (Ile, I)
n = 333 (8.76%)
Methionine (Met, M)
n = 252 (6.63%)
Proline (Pro, P)
n = 191 (5.03%)
Phenylalanine (Phe, F)
n = 243 (6.39%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 91 (2.39%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
159 174 209 65 103 302 28 89 83 5 35 50 89 13 101 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 5 17 37 88 110 11 40 57 98 20 45 60 83 3 33
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
96 171 14 45 78 94 6 16 43 59 75 11 17 45 121 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 83 12 21 45 88 7 7 11 44 2 1 0 6 1 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 932 1220 840
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
466 974 742 1619
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
193 1223 1644 741

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.