Viewing data for Cuora trifasciata


Scientific name Cuora trifasciata
Common name Chinese three-striped box turtle
Maximum lifespan 31.80 years (Cuora trifasciata@AnAge)

Total mtDNA (size: 16675 bases) GC AT G C A T
Base content (bases) 6556 10119 4367 2189 4475 5644
Base content per 1 kb (bases) 393 607 262 131 268 338
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11359 bases) GC AT G C A T
Base content (bases) 4592 6767 3195 1397 3046 3721
Base content per 1 kb (bases) 404 596 281 123 268 328
Base content (%) 40.4% 59.6%
D-loop (size: 1156 bases) GC AT G C A T
Base content (bases) 304 852 188 116 460 392
Base content per 1 kb (bases) 263 737 163 100 398 339
Base content (%) 26.3% 73.7%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 598 952 355 243 407 545
Base content per 1 kb (bases) 386 614 229 157 263 352
Base content (%) 38.6% 61.4%
Total rRNA-coding genes (size: 2568 bases) GC AT G C A T
Base content (bases) 1044 1524 613 431 547 977
Base content per 1 kb (bases) 407 593 239 168 213 380
Base content (%) 40.7% 59.3%
12S rRNA gene (size: 967 bases) GC AT G C A T
Base content (bases) 412 555 243 169 204 351
Base content per 1 kb (bases) 426 574 251 175 211 363
Base content (%) 42.6% 57.4%
16S rRNA gene (size: 1601 bases) GC AT G C A T
Base content (bases) 632 969 370 262 343 626
Base content per 1 kb (bases) 395 605 231 164 214 391
Base content (%) 39.5% 60.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 256 428 187 69 198 230
Base content per 1 kb (bases) 374 626 273 101 289 336
Base content (%) 37.4% 62.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 59 109 46 13 44 65
Base content per 1 kb (bases) 351 649 274 77 262 387
Base content (%) 35.1% 64.9%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 659 889 389 270 463 426
Base content per 1 kb (bases) 426 574 251 174 299 275
Base content (%) 42.6% 57.4%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 276 411 173 103 183 228
Base content per 1 kb (bases) 402 598 252 150 266 332
Base content (%) 40.2% 59.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 321 463 204 117 221 242
Base content per 1 kb (bases) 409 591 260 149 282 309
Base content (%) 40.9% 59.1%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 495 649 360 135 305 344
Base content per 1 kb (bases) 433 567 315 118 267 301
Base content (%) 43.3% 56.7%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 397 574 282 115 272 302
Base content per 1 kb (bases) 409 591 290 118 280 311
Base content (%) 40.9% 59.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 414 625 312 102 249 376
Base content per 1 kb (bases) 398 602 300 98 240 362
Base content (%) 39.8% 60.2%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 129 220 91 38 107 113
Base content per 1 kb (bases) 370 630 261 109 307 324
Base content (%) 37.0% 63.0%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 550 827 382 168 364 463
Base content per 1 kb (bases) 399 601 277 122 264 336
Base content (%) 39.9% 60.1%
ND4L (size: 300 bases) GC AT G C A T
Base content (bases) 121 179 84 37 95 84
Base content per 1 kb (bases) 403 597 280 123 317 280
Base content (%) 40.3% 59.7%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 713 1093 527 186 478 615
Base content per 1 kb (bases) 395 605 292 103 265 341
Base content (%) 39.5% 60.5%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 208 317 162 46 73 244
Base content per 1 kb (bases) 396 604 309 88 139 465
Base content (%) 39.6% 60.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 13 7 8 20 3 18 8 1 1 1 5 1 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 8 2 0 3 0 7 0 3 0 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 1 3 1 3 1 0 4 1 2 0 0 6 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 1 0 3 0 1 0 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 69 80 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 56 116 47
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNLDPWFLILSSTWLAYTMILQPKISSYLSMNNPANKDNKITNTNPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 2 0 1 3 1 2 2 0 0 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 0 0 0 1 0 3 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 1 3 1 0 0 0 1 1 0 0 3 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 1 1 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 13 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 17 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 14 25 13
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 47 (9.13%)
Serine (Ser, S)
n = 32 (6.21%)
Threonine (Thr, T)
n = 36 (6.99%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.8%)
Leucine (Leu, L)
n = 59 (11.46%)
Isoleucine (Ile, I)
n = 40 (7.77%)
Methionine (Met, M)
n = 31 (6.02%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 21 27 8 9 18 3 17 8 1 10 3 19 3 21 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 12 15 17 3 8 13 15 11 6 5 10 5 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 0 9 6 12 1 1 3 6 13 0 4 5 9 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 5 10 9 0 4 0 3 1 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 101 135 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 151 195 132
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 12 (5.26%)
Serine (Ser, S)
n = 19 (8.33%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 17 (7.46%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 17 (7.46%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 8 (3.51%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 12 (5.26%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 14 3 2 9 6 6 7 0 2 3 9 3 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 3 6 0 1 0 4 3 1 3 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 4 0 2 4 6 1 1 5 7 2 0 0 3 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 1 3 5 5 0 0 2 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 59 66 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 54 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 60 101 50
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 10 2 5 9 1 16 8 0 1 2 11 1 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 8 9 0 4 5 8 2 2 2 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 2 1 8 0 1 4 6 5 1 0 2 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 3 2 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 59 63 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 77 125 51
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.84%)
Alanine (Ala, A)
n = 22 (5.79%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 37 (9.74%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 11 (2.89%)
Leucine (Leu, L)
n = 61 (16.05%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 14 (3.68%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 10 (2.63%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 25 13 11 10 24 3 13 7 2 0 3 8 0 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 6 11 5 0 6 6 11 3 2 9 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 1 2 7 14 1 0 1 0 14 0 0 4 16 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 5 6 10 0 1 1 6 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 99 115 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 106 80 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 155 149 65
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 25 (7.76%)
Serine (Ser, S)
n = 26 (8.07%)
Threonine (Thr, T)
n = 21 (6.52%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.04%)
Leucine (Leu, L)
n = 56 (17.39%)
Isoleucine (Ile, I)
n = 23 (7.14%)
Methionine (Met, M)
n = 21 (6.52%)
Proline (Pro, P)
n = 25 (7.76%)
Phenylalanine (Phe, F)
n = 22 (6.83%)
Tyrosine (Tyr, Y)
n = 12 (3.73%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 14 (4.35%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 18 7 9 27 2 11 7 0 1 3 9 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 9 9 6 1 0 7 7 2 4 5 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 2 7 15 1 0 1 1 11 0 0 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 3 7 1 0 1 5 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 87 88 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 96 59 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 99 154 57
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 28 (8.12%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 53 (15.36%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 28 (8.12%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 10 (2.9%)
Glutamine (Gln, Q)
n = 16 (4.64%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 20 25 3 6 34 0 9 15 1 1 1 5 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 12 11 0 0 5 7 1 0 8 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 27 0 6 9 7 1 2 4 1 5 1 1 4 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 0 2 11 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 90 137 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 117 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 105 180 51
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 28 (8.12%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 53 (15.36%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 28 (8.12%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 10 (2.9%)
Glutamine (Gln, Q)
n = 16 (4.64%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 20 25 3 6 34 0 9 15 1 1 1 5 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 12 11 0 0 5 7 1 0 8 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 27 0 6 9 7 1 2 4 1 5 1 1 4 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 0 2 11 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 90 137 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 117 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 105 180 51
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (5.24%)
Alanine (Ala, A)
n = 36 (7.86%)
Serine (Ser, S)
n = 27 (5.9%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 7 (1.53%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 84 (18.34%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 15 (3.28%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 12 (2.62%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 37 8 8 39 4 23 12 1 0 3 6 1 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 6 8 14 13 1 3 7 9 5 2 6 16 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 22 0 3 6 13 0 2 3 6 6 3 2 3 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 0 0 2 10 1 1 2 8 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 119 155 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 133 75 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 130 233 74
ND4L (size: 300 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.05%)
Alanine (Ala, A)
n = 7 (7.07%)
Serine (Ser, S)
n = 13 (13.13%)
Threonine (Thr, T)
n = 7 (7.07%)
Cysteine (Cys, C)
n = 4 (4.04%)
Valine (Val, V)
n = 2 (2.02%)
Leucine (Leu, L)
n = 23 (23.23%)
Isoleucine (Ile, I)
n = 5 (5.05%)
Methionine (Met, M)
n = 9 (9.09%)
Proline (Pro, P)
n = 2 (2.02%)
Phenylalanine (Phe, F)
n = 6 (6.06%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.01%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.03%)
Asparagine (Asn, N)
n = 2 (2.02%)
Glutamine (Gln, Q)
n = 4 (4.04%)
Histidine (His, H)
n = 5 (5.05%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.01%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 7 5 0 11 1 5 4 0 0 0 2 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 3 1 0 0 2 2 1 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 1 4 6 0 1 1 0 0 1 1 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 0 0 0 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 29 25 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 27 15 45
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 28 44 21
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.66%)
Alanine (Ala, A)
n = 38 (6.32%)
Serine (Ser, S)
n = 48 (7.99%)
Threonine (Thr, T)
n = 65 (10.82%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 92 (15.31%)
Isoleucine (Ile, I)
n = 62 (10.32%)
Methionine (Met, M)
n = 41 (6.82%)
Proline (Pro, P)
n = 30 (4.99%)
Phenylalanine (Phe, F)
n = 34 (5.66%)
Tyrosine (Tyr, Y)
n = 13 (2.16%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 12 (2.0%)
Asparagine (Asn, N)
n = 33 (5.49%)
Glutamine (Gln, Q)
n = 16 (2.66%)
Histidine (His, H)
n = 15 (2.5%)
Lysine (Lys, K)
n = 23 (3.83%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 35 40 12 17 33 5 23 15 1 2 5 7 1 12 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 3 7 17 14 0 6 10 11 1 2 9 19 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 29 2 7 12 17 1 3 8 5 8 1 2 7 26 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 11 1 1 9 22 1 1 3 4 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 137 235 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 170 123 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 220 257 107
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.94%)
Alanine (Ala, A)
n = 9 (5.17%)
Serine (Ser, S)
n = 14 (8.05%)
Threonine (Thr, T)
n = 2 (1.15%)
Cysteine (Cys, C)
n = 5 (2.87%)
Valine (Val, V)
n = 24 (13.79%)
Leucine (Leu, L)
n = 29 (16.67%)
Isoleucine (Ile, I)
n = 8 (4.6%)
Methionine (Met, M)
n = 8 (4.6%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 0 2 6 0 0 0 11 1 0 12 1 4 7 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 5 0 4 0 1 4 8 1 3 14 2 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 1 2 0 5 0 10 0 2 12 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 4 0 0 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 16 25 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 24 20 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 6 28 91
Total protein-coding genes (size: 11382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.96%)
Alanine (Ala, A)
n = 267 (7.04%)
Serine (Ser, S)
n = 269 (7.1%)
Threonine (Thr, T)
n = 345 (9.1%)
Cysteine (Cys, C)
n = 34 (0.9%)
Valine (Val, V)
n = 158 (4.17%)
Leucine (Leu, L)
n = 604 (15.93%)
Isoleucine (Ile, I)
n = 313 (8.26%)
Methionine (Met, M)
n = 241 (6.36%)
Proline (Pro, P)
n = 212 (5.59%)
Phenylalanine (Phe, F)
n = 225 (5.94%)
Tyrosine (Tyr, Y)
n = 117 (3.09%)
Tryptophan (Trp, W)
n = 110 (2.9%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 103 (2.72%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
145 168 212 74 77 238 31 162 95 8 30 25 86 17 102 123
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 14 20 65 103 90 9 39 59 84 44 27 50 123 12 67
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 151 6 44 62 106 7 16 34 47 70 9 22 41 99 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 83 10 23 42 85 3 12 10 43 5 0 2 6 0 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 909 1179 895
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1043 716 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
214 1131 1665 782

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.