Viewing data for Aix galericulata


Scientific name Aix galericulata
Common name Mandarin duck
Maximum lifespan 10.40 years (Aix galericulata@AnAge)

Total mtDNA (size: 16605 bases) GC AT G C A T
Base content (bases) 8042 8563 5441 2601 3712 4851
Base content per 1 kb (bases) 484 516 328 157 224 292
Base content (%) 48.4% 51.6%
Total protein-coding genes (size: 11388 bases) GC AT G C A T
Base content (bases) 5645 5743 4004 1641 2538 3205
Base content per 1 kb (bases) 496 504 352 144 223 281
Base content (%) 49.6% 50.4%
D-loop (size: 1036 bases) GC AT G C A T
Base content (bases) 488 548 321 167 275 273
Base content per 1 kb (bases) 471 529 310 161 265 264
Base content (%) 47.1% 52.9%
Total tRNA-coding genes (size: 1543 bases) GC AT G C A T
Base content (bases) 672 871 397 275 374 497
Base content per 1 kb (bases) 436 564 257 178 242 322
Base content (%) 43.6% 56.4%
Total rRNA-coding genes (size: 2599 bases) GC AT G C A T
Base content (bases) 1217 1382 696 521 515 867
Base content per 1 kb (bases) 468 532 268 200 198 334
Base content (%) 46.8% 53.2%
12S rRNA gene (size: 997 bases) GC AT G C A T
Base content (bases) 490 507 284 206 194 313
Base content per 1 kb (bases) 491 509 285 207 195 314
Base content (%) 49.1% 50.9%
16S rRNA gene (size: 1602 bases) GC AT G C A T
Base content (bases) 727 875 412 315 321 554
Base content per 1 kb (bases) 454 546 257 197 200 346
Base content (%) 45.4% 54.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 251 84 157 192
Base content per 1 kb (bases) 490 510 367 123 230 281
Base content (%) 49.0% 51.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 85 83 69 16 31 52
Base content per 1 kb (bases) 506 494 411 95 185 310
Base content (%) 50.6% 49.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 775 776 510 265 375 401
Base content per 1 kb (bases) 500 500 329 171 242 259
Base content (%) 50.0% 50.0%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 345 342 229 116 149 193
Base content per 1 kb (bases) 502 498 333 169 217 281
Base content (%) 50.2% 49.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 386 398 261 125 192 206
Base content per 1 kb (bases) 492 508 333 159 245 263
Base content (%) 49.2% 50.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 568 575 402 166 274 301
Base content per 1 kb (bases) 497 503 352 145 240 263
Base content (%) 49.7% 50.3%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 481 497 334 147 239 258
Base content per 1 kb (bases) 492 508 342 150 244 264
Base content (%) 49.2% 50.8%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 520 519 387 133 218 301
Base content per 1 kb (bases) 500 500 372 128 210 290
Base content (%) 50.0% 50.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 170 182 119 51 88 94
Base content per 1 kb (bases) 483 517 338 145 250 267
Base content (%) 48.3% 51.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 672 706 494 178 313 393
Base content per 1 kb (bases) 488 512 358 129 227 285
Base content (%) 48.8% 51.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 156 141 104 52 67 74
Base content per 1 kb (bases) 525 475 350 175 226 249
Base content (%) 52.5% 47.5%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 900 924 649 251 378 546
Base content per 1 kb (bases) 493 507 356 138 207 299
Base content (%) 49.3% 50.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 257 265 198 59 61 204
Base content per 1 kb (bases) 492 508 379 113 117 391
Base content (%) 49.2% 50.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 6 3 18 26 8 6 6 1 1 4 4 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 10 6 1 0 6 2 0 1 6 8 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 3 3 3 1 0 5 1 2 2 0 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 4 0 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 88 65 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 66 35 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 97 92 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALLIQPKLLNFTSTNPPSDKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 0 6 1 1 0 1 1 0 1 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 2 0 0 0 0 0 1 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 1 0 0 0 3 1 0 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 19 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 24 23 3
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.4%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 33 16 4 17 30 7 4 10 0 5 12 9 7 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 5 33 7 1 2 18 21 6 4 13 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 13 2 5 10 8 1 0 3 2 15 0 1 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 8 2 5 10 9 0 0 1 6 1 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 125 135 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 246 171 63
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.33%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 4 4 9 12 4 1 6 1 3 6 8 2 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 9 4 0 0 4 3 2 1 5 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 0 7 9 1 1 3 2 6 1 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 1 2 11 3 1 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 65 49 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 61 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 104 83 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 7 4 11 10 3 3 5 1 5 4 4 0 5 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 12 7 1 0 9 11 0 3 4 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 1 2 4 6 1 0 5 3 7 1 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 1 3 4 0 0 0 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 68 60 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 53 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 122 93 33
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 33 (8.68%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 29 (7.63%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 26 5 6 16 28 9 4 7 1 1 6 9 2 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 1 22 9 1 0 9 9 5 1 10 12 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 5 1 2 9 10 2 0 2 4 10 1 0 2 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 2 2 5 9 1 0 3 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 111 94 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 105 79 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 186 128 37
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 17 (5.23%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 18 (5.54%)
Proline (Pro, P)
n = 26 (8.0%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 12 (3.69%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 13 4 16 22 11 7 3 3 1 6 7 3 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 19 10 0 1 7 5 1 4 14 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 1 2 11 9 0 0 6 3 11 2 1 0 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 2 0 4 7 0 0 1 7 0 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 95 82 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 144 121 30
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 34 (9.86%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 23 8 5 19 29 11 2 7 2 0 6 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 3 20 15 0 0 6 3 2 0 10 9 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 2 1 15 10 1 0 8 2 5 2 1 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 13 1 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 109 112 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 122 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 156 132 23
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 34 (9.86%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 23 8 5 19 29 11 2 7 2 0 6 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 3 20 15 0 0 6 3 2 0 10 9 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 2 1 15 10 1 0 8 2 5 2 1 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 13 1 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 109 112 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 122 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 156 132 23
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 36 (7.86%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 48 (10.48%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 13 (2.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 14 6 25 49 14 6 9 2 3 2 4 0 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 3 4 20 12 0 1 9 10 1 1 13 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 5 3 10 13 2 1 7 3 10 3 1 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 0 2 9 1 0 3 7 3 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 161 141 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 141 71 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 192 181 43
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 3 1 2 13 1 2 2 0 0 2 2 1 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 2 4 2 1 0 4 1 1 0 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 1 1 2 5 0 0 4 0 0 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 2 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 30 23 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 27 15 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 47 36 5
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.27%)
Alanine (Ala, A)
n = 61 (10.05%)
Serine (Ser, S)
n = 37 (6.1%)
Threonine (Thr, T)
n = 68 (11.2%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 108 (17.79%)
Isoleucine (Ile, I)
n = 50 (8.24%)
Methionine (Met, M)
n = 30 (4.94%)
Proline (Pro, P)
n = 33 (5.44%)
Phenylalanine (Phe, F)
n = 31 (5.11%)
Tyrosine (Tyr, Y)
n = 13 (2.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.15%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 24 (3.95%)
Glutamine (Gln, Q)
n = 15 (2.47%)
Histidine (His, H)
n = 17 (2.8%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 33 22 5 31 50 17 5 10 5 0 5 8 3 7 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 6 4 36 19 2 1 10 16 5 0 14 17 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
37 22 1 4 14 8 0 0 11 0 13 1 0 2 22 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 11 3 1 6 21 2 0 4 5 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 178 206 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 188 114 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 283 226 49
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.08%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 7 (4.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 3 0 2 1 4 0 0 15 0 5 13 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 1 4 5 4 2 3 18 2 1 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 4 0 2 2 3 1 6 1 1 16 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 1 2 0 0 1 0 0 6 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 17 21 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 30 16 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 12 24 64
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 342 (9.0%)
Serine (Ser, S)
n = 277 (7.29%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 185 (4.87%)
Leucine (Leu, L)
n = 667 (17.55%)
Isoleucine (Ile, I)
n = 284 (7.47%)
Methionine (Met, M)
n = 165 (4.34%)
Proline (Pro, P)
n = 233 (6.13%)
Phenylalanine (Phe, F)
n = 223 (5.87%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 120 (3.16%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 110 (2.89%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
73 211 104 47 178 286 90 46 70 17 34 54 64 33 56 167
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 2 26 34 197 99 12 9 85 87 42 18 99 103 13 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 113 16 28 85 89 14 5 56 26 82 15 20 8 112 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
102 76 21 12 50 82 7 1 19 43 13 0 2 7 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
909 1107 1030 755
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 1100 681 1524
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
377 1661 1360 403

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.