Viewing data for Trichiurus lepturus


Scientific name Trichiurus lepturus
Common name Atlantic cutlassfish
Maximum lifespan 15.00 years (Trichiurus lepturus@AnAge)

Total mtDNA (size: 17060 bases) GC AT G C A T
Base content (bases) 7771 9289 5007 2764 4431 4858
Base content per 1 kb (bases) 456 544 293 162 260 285
Base content (%) 45.6% 54.4%
Total protein-coding genes (size: 11439 bases) GC AT G C A T
Base content (bases) 5362 6077 3622 1740 3019 3058
Base content per 1 kb (bases) 469 531 317 152 264 267
Base content (%) 46.9% 53.1%
D-loop (size: 1384 bases) GC AT G C A T
Base content (bases) 429 955 238 191 483 472
Base content per 1 kb (bases) 310 690 172 138 349 341
Base content (%) 31.0% 69.0%
Total tRNA-coding genes (size: 1483 bases) GC AT G C A T
Base content (bases) 675 808 376 299 360 448
Base content per 1 kb (bases) 455 545 254 202 243 302
Base content (%) 45.5% 54.5%
Total rRNA-coding genes (size: 2682 bases) GC AT G C A T
Base content (bases) 1276 1406 753 523 548 858
Base content per 1 kb (bases) 476 524 281 195 204 320
Base content (%) 47.6% 52.4%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 452 505 254 198 208 297
Base content per 1 kb (bases) 472 528 265 207 217 310
Base content (%) 47.2% 52.8%
16S rRNA gene (size: 1725 bases) GC AT G C A T
Base content (bases) 824 901 499 325 340 561
Base content per 1 kb (bases) 478 522 289 188 197 325
Base content (%) 47.8% 52.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 314 370 215 99 189 181
Base content per 1 kb (bases) 459 541 314 145 276 265
Base content (%) 45.9% 54.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 50 20 49 49
Base content per 1 kb (bases) 417 583 298 119 292 292
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 739 812 453 286 429 383
Base content per 1 kb (bases) 476 524 292 184 277 247
Base content (%) 47.6% 52.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 313 378 204 109 175 203
Base content per 1 kb (bases) 453 547 295 158 253 294
Base content (%) 45.3% 54.7%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 388 397 252 136 209 188
Base content per 1 kb (bases) 494 506 321 173 266 239
Base content (%) 49.4% 50.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 527 614 358 169 332 282
Base content per 1 kb (bases) 462 538 314 148 291 247
Base content (%) 46.2% 53.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 455 520 312 143 264 256
Base content per 1 kb (bases) 467 533 320 147 271 263
Base content (%) 46.7% 53.3%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 501 545 369 132 251 294
Base content per 1 kb (bases) 479 521 353 126 240 281
Base content (%) 47.9% 52.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 167 182 113 54 109 73
Base content per 1 kb (bases) 479 521 324 155 312 209
Base content (%) 47.9% 52.1%
ND4 (size: 1371 bases) GC AT G C A T
Base content (bases) 623 748 411 212 363 385
Base content per 1 kb (bases) 454 546 300 155 265 281
Base content (%) 45.4% 54.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 102 47 82 66
Base content per 1 kb (bases) 502 498 343 158 276 222
Base content (%) 50.2% 49.8%
ND5 (size: 1881 bases) GC AT G C A T
Base content (bases) 875 1006 621 254 490 516
Base content per 1 kb (bases) 465 535 330 135 260 274
Base content (%) 46.5% 53.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 247 275 165 82 82 193
Base content per 1 kb (bases) 473 527 316 157 157 370
Base content (%) 47.3% 52.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 43 (18.94%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 7 (3.08%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 7 7 5 16 12 1 7 2 4 2 2 7 3 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 10 6 0 0 3 6 1 1 7 5 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 1 2 1 4 3 1 4 0 3 1 2 1 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 1 1 1 0 1 1 4 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 70 66 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 63 35 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 82 80 44
ATP8 (size: 168 bases)
Amino acid sequence: MPQLKPSPWLHIFLLAWASFLVILPCKVISFIYPSSPETQEEKTTLDTPWTWQWQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 0 2 1 0 0 3 3 1 1 1 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 0 1 0 0 0 0 0 3 3 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 2 0 1 0 1 0 1 1 1 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 1 0 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 15 14 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 18 14 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 17 21 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 51 (9.88%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 27 (5.23%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 12 15 12 23 6 8 4 3 12 11 10 6 20 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 0 1 6 31 10 4 4 18 17 8 3 14 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 2 3 10 8 1 0 4 2 15 1 0 6 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 11 0 4 10 8 1 2 1 5 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
162 118 128 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 198 162 110
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 18 (7.86%)
Cysteine (Cys, C)
n = 3 (1.31%)
Valine (Val, V)
n = 15 (6.55%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 12 (5.24%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 7 (3.06%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 6 7 7 8 2 1 6 1 4 8 3 0 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 7 4 6 0 1 2 5 1 2 5 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 2 3 5 4 1 1 1 3 6 1 0 3 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 1 2 11 4 0 0 1 5 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 59 63 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 63 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 85 77 53
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 5 8 11 9 2 4 6 2 3 7 7 1 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 7 10 0 2 12 6 2 2 8 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 2 3 6 1 0 0 3 4 8 2 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 0 5 0 1 2 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 70 52 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 70 52 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 112 83 50
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 37 (9.76%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 15 8 13 15 20 5 5 2 3 4 4 12 1 12 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 3 17 7 1 3 7 10 5 7 10 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 2 8 8 4 2 0 1 5 8 3 0 6 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 1 10 7 1 0 3 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 100 94 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 97 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 161 112 81
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 64 (19.75%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 9 14 13 18 3 15 4 3 4 5 5 1 5 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 19 11 0 2 5 9 1 2 13 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 5 1 2 5 10 1 0 4 2 10 3 1 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 4 0 3 4 3 0 1 7 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 88 81 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 57 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 129 118 54
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 75 (21.61%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 9 15 20 27 8 3 11 3 2 3 1 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 16 15 0 1 6 7 2 3 11 5 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 1 4 6 4 1 2 3 1 6 1 2 2 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 3 9 0 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 117 110 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 122 56 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 130 127 64
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 75 (21.61%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 9 15 20 27 8 3 11 3 2 3 1 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 16 15 0 1 6 7 2 3 11 5 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 1 4 6 4 1 2 3 1 6 1 2 2 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 3 9 0 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 117 110 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 122 56 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 130 127 64
ND4 (size: 1371 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.82%)
Alanine (Ala, A)
n = 50 (10.96%)
Serine (Ser, S)
n = 30 (6.58%)
Threonine (Thr, T)
n = 42 (9.21%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 16 (3.51%)
Leucine (Leu, L)
n = 86 (18.86%)
Isoleucine (Ile, I)
n = 34 (7.46%)
Methionine (Met, M)
n = 27 (5.92%)
Proline (Pro, P)
n = 27 (5.92%)
Phenylalanine (Phe, F)
n = 19 (4.17%)
Tyrosine (Tyr, Y)
n = 13 (2.85%)
Tryptophan (Trp, W)
n = 15 (3.29%)
Aspartic acid (Asp, D)
n = 5 (1.1%)
Glutamic acid (Glu, E)
n = 12 (2.63%)
Asparagine (Asn, N)
n = 13 (2.85%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 13 18 17 12 26 13 15 9 0 9 2 4 1 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 12 23 15 0 1 6 10 5 2 13 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 22 1 2 9 7 2 2 8 6 7 3 3 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 5 0 5 10 1 0 4 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 125 138 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 139 73 182
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 147 174 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 7 5 5 1 4 2 0 0 0 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 6 4 1 1 2 1 1 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 1 1 3 5 0 0 4 0 1 0 2 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 1 0 1 1 0 1 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 29 22 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 32 13 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 41 31 18
ND5 (size: 1881 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (4.95%)
Alanine (Ala, A)
n = 54 (8.63%)
Serine (Ser, S)
n = 44 (7.03%)
Threonine (Thr, T)
n = 62 (9.9%)
Cysteine (Cys, C)
n = 11 (1.76%)
Valine (Val, V)
n = 22 (3.51%)
Leucine (Leu, L)
n = 101 (16.13%)
Isoleucine (Ile, I)
n = 54 (8.63%)
Methionine (Met, M)
n = 24 (3.83%)
Proline (Pro, P)
n = 32 (5.11%)
Phenylalanine (Phe, F)
n = 50 (7.99%)
Tyrosine (Tyr, Y)
n = 11 (1.76%)
Tryptophan (Trp, W)
n = 11 (1.76%)
Aspartic acid (Asp, D)
n = 12 (1.92%)
Glutamic acid (Glu, E)
n = 11 (1.76%)
Asparagine (Asn, N)
n = 25 (3.99%)
Glutamine (Gln, Q)
n = 18 (2.88%)
Histidine (His, H)
n = 20 (3.19%)
Lysine (Lys, K)
n = 21 (3.35%)
Arginine (Arg, R)
n = 12 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 28 20 18 36 25 11 11 13 5 5 6 5 6 14 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 9 9 28 16 1 2 9 12 8 5 13 13 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 26 3 3 17 10 2 2 10 2 9 1 0 6 19 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 4 8 17 4 1 1 9 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 172 198 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 180 119 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 269 199 112
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 19 (10.98%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 7 (4.05%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 1 4 1 1 4 8 0 1 9 4 6 6 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 6 2 5 5 1 1 6 14 2 1 1 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 8 1 3 4 3 0 8 0 3 8 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 4 4 0 1 0 1 0 1 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 22 24 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 45 24 72
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 15 34 66
Total protein-coding genes (size: 11461 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 232 (6.08%)
Alanine (Ala, A)
n = 350 (9.17%)
Serine (Ser, S)
n = 251 (6.58%)
Threonine (Thr, T)
n = 322 (8.44%)
Cysteine (Cys, C)
n = 33 (0.86%)
Valine (Val, V)
n = 199 (5.21%)
Leucine (Leu, L)
n = 632 (16.56%)
Isoleucine (Ile, I)
n = 286 (7.49%)
Methionine (Met, M)
n = 155 (4.06%)
Proline (Pro, P)
n = 218 (5.71%)
Phenylalanine (Phe, F)
n = 256 (6.71%)
Tyrosine (Tyr, Y)
n = 110 (2.88%)
Tryptophan (Trp, W)
n = 112 (2.93%)
Aspartic acid (Asp, D)
n = 79 (2.07%)
Glutamic acid (Glu, E)
n = 102 (2.67%)
Asparagine (Asn, N)
n = 117 (3.07%)
Glutamine (Gln, Q)
n = 91 (2.38%)
Histidine (His, H)
n = 110 (2.88%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 78 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
156 130 101 132 155 179 59 86 65 26 56 55 62 26 104 152
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 7 26 65 166 106 13 18 73 91 50 33 106 68 11 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
126 136 18 40 77 62 18 11 43 34 76 21 21 34 83 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
88 82 20 18 61 65 12 8 16 50 4 1 0 6 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
962 1022 1012 822
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
510 1087 693 1528
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
354 1433 1251 780

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.