Viewing data for Alligator mississippiensis


Scientific name Alligator mississippiensis
Common name American alligator
Maximum lifespan 73.10 years (Alligator mississippiensis@AnAge)

Total mtDNA (size: 16646 bases) GC AT G C A T
Base content (bases) 7163 9483 4911 2252 4283 5200
Base content per 1 kb (bases) 430 570 295 135 257 312
Base content (%) 43.0% 57.0%
Total protein-coding genes (size: 11381 bases) GC AT G C A T
Base content (bases) 4949 6432 3556 1393 2987 3445
Base content per 1 kb (bases) 435 565 312 122 262 303
Base content (%) 43.5% 56.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1589 bases) GC AT G C A T
Base content (bases) 687 902 414 273 379 523
Base content per 1 kb (bases) 432 568 261 172 239 329
Base content (%) 43.2% 56.8%
Total rRNA-coding genes (size: 2566 bases) GC AT G C A T
Base content (bases) 1138 1428 669 469 534 894
Base content per 1 kb (bases) 443 557 261 183 208 348
Base content (%) 44.3% 55.7%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 469 507 265 204 190 317
Base content per 1 kb (bases) 481 519 272 209 195 325
Base content (%) 48.1% 51.9%
16S rRNA gene (size: 1590 bases) GC AT G C A T
Base content (bases) 669 921 404 265 344 577
Base content per 1 kb (bases) 421 579 254 167 216 363
Base content (%) 42.1% 57.9%

ATP6 (size: 678 bases) GC AT G C A T
Base content (bases) 295 383 229 66 179 204
Base content per 1 kb (bases) 435 565 338 97 264 301
Base content (%) 43.5% 56.5%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 67 95 54 13 39 56
Base content per 1 kb (bases) 414 586 333 80 241 346
Base content (%) 41.4% 58.6%
COX1 (size: 1555 bases) GC AT G C A T
Base content (bases) 691 864 445 246 421 443
Base content per 1 kb (bases) 444 556 286 158 271 285
Base content (%) 44.4% 55.6%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 299 389 214 85 170 219
Base content per 1 kb (bases) 435 565 311 124 247 318
Base content (%) 43.5% 56.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 362 422 247 115 208 214
Base content per 1 kb (bases) 462 538 315 147 265 273
Base content (%) 46.2% 53.8%
CYTB (size: 1159 bases) GC AT G C A T
Base content (bases) 511 648 366 145 315 333
Base content per 1 kb (bases) 441 559 316 125 272 287
Base content (%) 44.1% 55.9%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 428 538 296 132 269 269
Base content per 1 kb (bases) 443 557 306 137 278 278
Base content (%) 44.3% 55.7%
ND2 (size: 1062 bases) GC AT G C A T
Base content (bases) 422 640 320 102 289 351
Base content per 1 kb (bases) 397 603 301 96 272 331
Base content (%) 39.7% 60.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 153 195 109 44 97 98
Base content per 1 kb (bases) 440 560 313 126 279 282
Base content (%) 44.0% 56.0%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 595 779 440 155 366 413
Base content per 1 kb (bases) 433 567 320 113 266 301
Base content (%) 43.3% 56.7%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 131 163 91 40 85 78
Base content per 1 kb (bases) 446 554 310 136 289 265
Base content (%) 44.6% 55.4%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 771 1041 565 206 475 566
Base content per 1 kb (bases) 425 575 312 114 262 312
Base content (%) 42.5% 57.5%
ND6 (size: 516 bases) GC AT G C A T
Base content (bases) 228 288 183 45 78 210
Base content per 1 kb (bases) 442 558 355 87 151 407
Base content (%) 44.2% 55.8%

ATP6 (size: 678 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.11%)
Alanine (Ala, A)
n = 13 (5.78%)
Serine (Ser, S)
n = 15 (6.67%)
Threonine (Thr, T)
n = 24 (10.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.11%)
Leucine (Leu, L)
n = 60 (26.67%)
Isoleucine (Ile, I)
n = 23 (10.22%)
Methionine (Met, M)
n = 10 (4.44%)
Proline (Pro, P)
n = 16 (7.11%)
Phenylalanine (Phe, F)
n = 7 (3.11%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.78%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.78%)
Asparagine (Asn, N)
n = 10 (4.44%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 5 (2.22%)
Lysine (Lys, K)
n = 4 (1.78%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 7 4 13 24 5 11 9 0 0 4 2 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 8 2 0 0 4 0 3 2 5 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 1 7 3 1 0 3 2 1 0 3 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 4 0 0 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
32 79 74 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 65 37 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 85 93 31
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLTTFLIVWISLIVILQPKIASLMLTSSPTPYKAMTIKTWPWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.77%)
Serine (Ser, S)
n = 4 (7.55%)
Threonine (Thr, T)
n = 7 (13.21%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.77%)
Leucine (Leu, L)
n = 7 (13.21%)
Isoleucine (Ile, I)
n = 6 (11.32%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 1 (1.89%)
Tyrosine (Tyr, Y)
n = 1 (1.89%)
Tryptophan (Trp, W)
n = 5 (9.43%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 1 (1.89%)
Glutamine (Gln, Q)
n = 2 (3.77%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.66%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 2 1 3 3 0 0 2 0 2 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 0 0 0 0 0 0 3 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 0 1 1 0 0 2 0 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 22 10
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 19 9 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 18 25 10
COX1 (size: 1555 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 39 (7.54%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 42 (8.12%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 37 (7.16%)
Leucine (Leu, L)
n = 59 (11.41%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 28 (5.42%)
Proline (Pro, P)
n = 31 (6.0%)
Phenylalanine (Phe, F)
n = 45 (8.7%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.48%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 16 24 8 14 26 0 11 7 1 4 9 19 5 18 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 6 18 15 0 2 8 24 10 3 12 16 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 0 6 11 7 1 1 4 8 11 1 0 1 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 2 3 11 9 0 1 1 6 1 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
143 114 142 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 194 206 93
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 10 (4.39%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.7%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 12 (5.26%)
Proline (Pro, P)
n = 15 (6.58%)
Phenylalanine (Phe, F)
n = 12 (5.26%)
Tyrosine (Tyr, Y)
n = 10 (4.39%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 11 3 7 14 1 5 8 0 3 3 7 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 5 5 0 0 1 5 2 3 4 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 4 4 6 0 0 2 1 9 1 0 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 4 7 3 0 0 4 1 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 62 64 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 58 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 94 93 34
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 10 (3.85%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 5 9 4 12 11 3 5 7 0 4 7 7 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 11 5 0 2 6 9 1 2 6 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 2 2 5 2 1 3 5 8 0 0 1 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 0 4 2 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 70 59 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 68 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 109 99 45
CYTB (size: 1159 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.23%)
Alanine (Ala, A)
n = 28 (7.27%)
Serine (Ser, S)
n = 31 (8.05%)
Threonine (Thr, T)
n = 28 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.64%)
Leucine (Leu, L)
n = 65 (16.88%)
Isoleucine (Ile, I)
n = 31 (8.05%)
Methionine (Met, M)
n = 18 (4.68%)
Proline (Pro, P)
n = 27 (7.01%)
Phenylalanine (Phe, F)
n = 28 (7.27%)
Tyrosine (Tyr, Y)
n = 13 (3.38%)
Tryptophan (Trp, W)
n = 12 (3.12%)
Aspartic acid (Asp, D)
n = 7 (1.82%)
Glutamic acid (Glu, E)
n = 7 (1.82%)
Asparagine (Asn, N)
n = 15 (3.9%)
Glutamine (Gln, Q)
n = 8 (2.08%)
Histidine (His, H)
n = 12 (3.12%)
Lysine (Lys, K)
n = 9 (2.34%)
Arginine (Arg, R)
n = 9 (2.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 16 8 14 30 3 9 6 2 5 3 5 1 11 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 12 10 0 0 8 14 2 3 9 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 1 5 10 12 0 0 4 5 8 1 1 6 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 1 6 7 2 0 5 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 111 105 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 110 71 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 145 157 68
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.05%)
Alanine (Ala, A)
n = 30 (9.35%)
Serine (Ser, S)
n = 29 (9.03%)
Threonine (Thr, T)
n = 28 (8.72%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.05%)
Leucine (Leu, L)
n = 66 (20.56%)
Isoleucine (Ile, I)
n = 14 (4.36%)
Methionine (Met, M)
n = 23 (7.17%)
Proline (Pro, P)
n = 24 (7.48%)
Phenylalanine (Phe, F)
n = 17 (5.3%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 5 (1.56%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 8 (2.49%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 17 15 12 24 4 11 4 1 5 3 4 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 6 11 11 2 0 4 9 0 2 11 10 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 0 4 6 10 2 3 4 5 4 4 0 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 1 1 4 6 1 1 1 4 1 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 95 87 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 104 49 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 97 133 67
ND2 (size: 1062 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.83%)
Alanine (Ala, A)
n = 26 (7.37%)
Serine (Ser, S)
n = 36 (10.2%)
Threonine (Thr, T)
n = 45 (12.75%)
Cysteine (Cys, C)
n = 1 (0.28%)
Valine (Val, V)
n = 13 (3.68%)
Leucine (Leu, L)
n = 67 (18.98%)
Isoleucine (Ile, I)
n = 37 (10.48%)
Methionine (Met, M)
n = 16 (4.53%)
Proline (Pro, P)
n = 16 (4.53%)
Phenylalanine (Phe, F)
n = 15 (4.25%)
Tyrosine (Tyr, Y)
n = 9 (2.55%)
Tryptophan (Trp, W)
n = 9 (2.55%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.27%)
Asparagine (Asn, N)
n = 10 (2.83%)
Glutamine (Gln, Q)
n = 11 (3.12%)
Histidine (His, H)
n = 4 (1.13%)
Lysine (Lys, K)
n = 14 (3.97%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 11 5 14 33 3 12 10 1 3 1 7 2 9 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 3 7 14 2 0 4 6 0 0 5 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 16 0 7 13 10 1 2 3 2 7 0 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 0 0 1 14 0 0 1 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 91 127 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 118 58 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 111 166 63
ND3 (size: 1062 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.83%)
Alanine (Ala, A)
n = 26 (7.37%)
Serine (Ser, S)
n = 36 (10.2%)
Threonine (Thr, T)
n = 45 (12.75%)
Cysteine (Cys, C)
n = 1 (0.28%)
Valine (Val, V)
n = 13 (3.68%)
Leucine (Leu, L)
n = 67 (18.98%)
Isoleucine (Ile, I)
n = 37 (10.48%)
Methionine (Met, M)
n = 16 (4.53%)
Proline (Pro, P)
n = 16 (4.53%)
Phenylalanine (Phe, F)
n = 15 (4.25%)
Tyrosine (Tyr, Y)
n = 9 (2.55%)
Tryptophan (Trp, W)
n = 9 (2.55%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.27%)
Asparagine (Asn, N)
n = 10 (2.83%)
Glutamine (Gln, Q)
n = 11 (3.12%)
Histidine (His, H)
n = 4 (1.13%)
Lysine (Lys, K)
n = 14 (3.97%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 11 5 14 33 3 12 10 1 3 1 7 2 9 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 3 7 14 2 0 4 6 0 0 5 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 16 0 7 13 10 1 2 3 2 7 0 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 0 0 1 14 0 0 1 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 91 127 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 118 58 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 111 166 63
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.38%)
Alanine (Ala, A)
n = 31 (6.78%)
Serine (Ser, S)
n = 34 (7.44%)
Threonine (Thr, T)
n = 55 (12.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.41%)
Leucine (Leu, L)
n = 97 (21.23%)
Isoleucine (Ile, I)
n = 43 (9.41%)
Methionine (Met, M)
n = 28 (6.13%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 16 (3.5%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 10 (2.19%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 23 14 23 38 5 16 14 0 1 2 7 1 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 8 12 10 1 3 10 4 3 3 12 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 20 4 4 6 14 2 0 8 4 9 2 1 2 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 2 1 6 7 1 0 4 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 139 157 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 138 75 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 163 181 85
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.15%)
Alanine (Ala, A)
n = 7 (7.22%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 12 (12.37%)
Cysteine (Cys, C)
n = 4 (4.12%)
Valine (Val, V)
n = 3 (3.09%)
Leucine (Leu, L)
n = 22 (22.68%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 6 (6.19%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 5 (5.15%)
Tyrosine (Tyr, Y)
n = 1 (1.03%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.03%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 3 (3.09%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 4 (4.12%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 1 (1.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 6 4 2 8 3 4 1 0 1 2 0 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 2 2 3 2 0 0 3 2 0 0 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 3 1 4 2 2 0 1 0 1 0 1 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 25 30 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 30 14 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 36 34 17
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.15%)
Alanine (Ala, A)
n = 54 (8.96%)
Serine (Ser, S)
n = 47 (7.79%)
Threonine (Thr, T)
n = 59 (9.78%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 17 (2.82%)
Leucine (Leu, L)
n = 90 (14.93%)
Isoleucine (Ile, I)
n = 53 (8.79%)
Methionine (Met, M)
n = 37 (6.14%)
Proline (Pro, P)
n = 31 (5.14%)
Phenylalanine (Phe, F)
n = 44 (7.3%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 9 (1.49%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 9 (1.49%)
Asparagine (Asn, N)
n = 29 (4.81%)
Glutamine (Gln, Q)
n = 17 (2.82%)
Histidine (His, H)
n = 18 (2.99%)
Lysine (Lys, K)
n = 27 (4.48%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 24 31 13 23 37 6 11 14 3 1 7 8 1 13 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 3 10 19 25 0 2 8 13 2 5 13 7 6 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 14 1 8 8 16 3 2 10 7 5 1 0 6 23 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 1 10 26 1 2 1 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 153 217 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 179 124 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 233 225 116
ND6 (size: 516 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.45%)
Alanine (Ala, A)
n = 11 (6.43%)
Serine (Ser, S)
n = 13 (7.6%)
Threonine (Thr, T)
n = 4 (2.34%)
Cysteine (Cys, C)
n = 6 (3.51%)
Valine (Val, V)
n = 26 (15.2%)
Leucine (Leu, L)
n = 20 (11.7%)
Isoleucine (Ile, I)
n = 5 (2.92%)
Methionine (Met, M)
n = 7 (4.09%)
Proline (Pro, P)
n = 2 (1.17%)
Phenylalanine (Phe, F)
n = 21 (12.28%)
Tyrosine (Tyr, Y)
n = 5 (2.92%)
Tryptophan (Trp, W)
n = 10 (5.85%)
Aspartic acid (Asp, D)
n = 3 (1.75%)
Glutamic acid (Glu, E)
n = 4 (2.34%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 2 (1.17%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.17%)
Arginine (Arg, R)
n = 6 (3.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 2 2 0 0 1 11 0 2 7 1 6 12 17 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 5 1 2 1 2 6 3 1 4 15 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 3 0 2 0 8 0 5 0 7 6 0 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 3 0 0 2 3 1 2 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 14 27 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 22 17 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
62 9 34 67
Total protein-coding genes (size: 11398 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 203 (5.35%)
Alanine (Ala, A)
n = 279 (7.35%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 356 (9.38%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 178 (4.69%)
Leucine (Leu, L)
n = 641 (16.88%)
Isoleucine (Ile, I)
n = 302 (7.95%)
Methionine (Met, M)
n = 202 (5.32%)
Proline (Pro, P)
n = 217 (5.72%)
Phenylalanine (Phe, F)
n = 243 (6.4%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 86 (2.26%)
Asparagine (Asn, N)
n = 128 (3.37%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 102 (2.69%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 69 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 142 162 83 142 259 36 109 82 11 37 43 74 24 101 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 12 16 51 114 103 11 13 60 92 38 28 83 96 10 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
158 133 11 46 74 92 14 17 44 44 66 17 12 25 103 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
81 73 13 14 54 85 7 7 20 38 4 0 1 7 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
814 1001 1142 841
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 1078 687 1566
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
250 1342 1493 713

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.