Viewing data for Axis axis


Scientific name Axis axis
Common name Chital
Maximum lifespan 20.80 years (Axis axis@AnAge)

Total mtDNA (size: 16349 bases) GC AT G C A T
Base content (bases) 6088 10261 3924 2164 4790 5471
Base content per 1 kb (bases) 372 628 240 132 293 335
Base content (%) 37.2% 62.8%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4201 7137 2859 1342 3444 3693
Base content per 1 kb (bases) 371 629 252 118 304 326
Base content (%) 37.1% 62.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 546 969 310 236 428 541
Base content per 1 kb (bases) 360 640 205 156 283 357
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 964 1561 522 442 619 942
Base content per 1 kb (bases) 382 618 207 175 245 373
Base content (%) 38.2% 61.8%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 379 576 208 171 230 346
Base content per 1 kb (bases) 397 603 218 179 241 362
Base content (%) 39.7% 60.3%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 585 985 314 271 389 596
Base content per 1 kb (bases) 373 627 200 173 248 380
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 249 432 170 79 215 217
Base content per 1 kb (bases) 366 634 250 116 316 319
Base content (%) 36.6% 63.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 59 142 48 11 58 84
Base content per 1 kb (bases) 294 706 239 55 289 418
Base content (%) 29.4% 70.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 583 962 332 251 514 448
Base content per 1 kb (bases) 377 623 215 162 333 290
Base content (%) 37.7% 62.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 254 430 158 96 193 237
Base content per 1 kb (bases) 371 629 231 140 282 346
Base content (%) 37.1% 62.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 320 464 210 110 244 220
Base content per 1 kb (bases) 408 592 268 140 311 281
Base content (%) 40.8% 59.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 438 702 292 146 347 355
Base content per 1 kb (bases) 384 616 256 128 304 311
Base content (%) 38.4% 61.6%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 362 594 252 110 291 303
Base content per 1 kb (bases) 379 621 264 115 304 317
Base content (%) 37.9% 62.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 364 678 274 90 293 385
Base content per 1 kb (bases) 349 651 263 86 281 369
Base content (%) 34.9% 65.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 137 209 95 42 103 106
Base content per 1 kb (bases) 396 604 275 121 298 306
Base content (%) 39.6% 60.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 505 873 366 139 424 449
Base content per 1 kb (bases) 366 634 266 101 308 326
Base content (%) 36.6% 63.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 98 199 61 37 106 93
Base content per 1 kb (bases) 330 670 205 125 357 313
Base content (%) 33.0% 67.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 661 1160 466 195 556 604
Base content per 1 kb (bases) 363 637 256 107 305 332
Base content (%) 36.3% 63.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 147 42 123 216
Base content per 1 kb (bases) 358 642 278 80 233 409
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 14 8 6 15 3 8 9 0 4 1 7 0 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 8 7 0 1 3 7 1 2 2 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 0 2 2 5 0 2 3 1 1 0 2 9 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 3 1 1 2 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 63 78 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 61 37 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 46 102 71
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLMMIMSMFLTLFIIFQLKISKHNFYFNPEPTLAKTQKQNTPWETKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 2 1 3 0 3 5 0 0 0 0 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 1 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 1 2 0 0 0 2 0 0 1 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 27 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 21 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 12 36 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 11 26 10 3 14 6 23 6 0 10 5 21 1 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 14 9 13 3 10 12 21 4 13 4 10 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 22 1 8 6 14 0 1 2 13 6 0 3 13 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 7 8 9 0 0 3 5 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 92 141 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 108 211 169
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 12 2 3 15 4 10 4 2 5 2 6 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 4 1 3 0 2 1 5 0 1 4 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 13 1 5 4 5 2 1 4 8 3 0 0 4 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 3 3 7 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 56 67 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 47 109 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 8 7 2 11 0 11 7 0 2 6 5 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 6 6 2 0 1 10 6 3 1 5 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 5 2 7 1 2 2 4 7 1 1 5 3 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 1 2 2 0 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 61 66 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 83 98 71
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 44 (11.61%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 15 13 8 11 24 2 10 5 1 4 6 4 3 15 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 3 2 18 0 3 4 17 0 3 6 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 1 4 5 11 0 0 3 7 8 2 1 7 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 6 5 9 0 0 1 7 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 93 116 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 76 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 108 163 96
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 18 (5.68%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 16 3 8 29 0 14 7 0 1 4 8 1 14 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 10 16 0 1 5 4 2 7 8 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 14 0 3 8 9 0 1 2 6 5 0 0 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 7 0 1 1 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 80 93 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 55 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 84 154 71
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 34 5 9 31 0 9 10 0 6 3 4 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 1 7 7 1 1 4 9 0 3 7 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 4 4 18 0 0 2 6 2 1 1 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 84 146 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 90 181 64
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 34 5 9 31 0 9 10 0 6 3 4 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 1 7 7 1 1 4 9 0 3 7 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 4 4 18 0 0 2 6 2 1 1 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 84 146 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 90 181 64
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 12 31 13 17 40 2 19 11 0 2 5 9 0 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 7 9 10 0 2 8 7 1 4 8 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 0 5 12 12 1 2 9 14 3 1 1 10 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 0 0 3 11 0 0 2 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 124 158 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 112 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 130 206 111
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 10 3 2 7 0 11 2 0 2 1 4 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 3 6 0 1 0 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 3 3 2 0 1 0 2 2 0 0 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 18 27 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 20 49 25
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 52 (8.58%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 12 (1.98%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 66 (10.89%)
Methionine (Met, M)
n = 45 (7.43%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 50 (8.25%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 13 (2.15%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 10 (1.65%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
43 23 40 12 13 36 8 15 18 1 2 2 8 0 24 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 8 13 19 1 6 8 14 0 3 13 10 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 2 10 12 11 1 2 11 9 11 1 1 22 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 2 6 7 20 2 0 5 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 132 233 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 153 131 258
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 181 240 161
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 5 2 0 1 2 11 2 0 7 0 7 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 0 1 2 12 0 4 10 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 2 4 1 0 2 4 0 8 2 1 2 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 1 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 11 49 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 5 41 86
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 241 (6.35%)
Serine (Ser, S)
n = 277 (7.29%)
Threonine (Thr, T)
n = 301 (7.93%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 180 (4.74%)
Leucine (Leu, L)
n = 588 (15.48%)
Isoleucine (Ile, I)
n = 347 (9.14%)
Methionine (Met, M)
n = 265 (6.98%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 252 (6.64%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 90 (2.37%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
233 114 218 82 79 238 27 149 89 4 46 35 85 14 143 109
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
47 3 19 52 77 105 7 41 55 99 22 42 62 86 3 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
63 165 10 53 62 99 7 18 38 82 51 7 13 91 75 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
52 79 18 31 37 88 6 4 17 40 2 1 0 7 0 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
803 865 1230 901
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 956 748 1632
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
187 945 1645 1022

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.