Viewing data for Capricornis sumatraensis


Scientific name Capricornis sumatraensis
Common name Serow
Maximum lifespan 18.50 years (Capricornis sumatraensis@AnAge)

Total mtDNA (size: 16441 bases) GC AT G C A T
Base content (bases) 6531 9910 4367 2164 4395 5515
Base content per 1 kb (bases) 397 603 266 132 267 335
Base content (%) 39.7% 60.3%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4542 6793 3211 1331 3085 3708
Base content per 1 kb (bases) 401 599 283 117 272 327
Base content (%) 40.1% 59.9%
D-loop (size: 831 bases) GC AT G C A T
Base content (bases) 336 495 197 139 236 259
Base content per 1 kb (bases) 404 596 237 167 284 312
Base content (%) 40.4% 59.6%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 539 972 315 224 432 540
Base content per 1 kb (bases) 357 643 208 148 286 357
Base content (%) 35.7% 64.3%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 1018 1509 571 447 576 933
Base content per 1 kb (bases) 403 597 226 177 228 369
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 408 551 238 170 202 349
Base content per 1 kb (bases) 425 575 248 177 211 364
Base content (%) 42.5% 57.5%
16S rRNA gene (size: 1568 bases) GC AT G C A T
Base content (bases) 610 958 333 277 374 584
Base content per 1 kb (bases) 389 611 212 177 239 372
Base content (%) 38.9% 61.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 189 72 195 225
Base content per 1 kb (bases) 383 617 278 106 286 330
Base content (%) 38.3% 61.7%
ATP8 (size: 198 bases) GC AT G C A T
Base content (bases) 68 130 49 19 55 75
Base content per 1 kb (bases) 343 657 247 96 278 379
Base content (%) 34.3% 65.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 654 891 396 258 453 438
Base content per 1 kb (bases) 423 577 256 167 293 283
Base content (%) 42.3% 57.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 272 412 172 100 180 232
Base content per 1 kb (bases) 398 602 251 146 263 339
Base content (%) 39.8% 60.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 366 418 249 117 214 204
Base content per 1 kb (bases) 467 533 318 149 273 260
Base content (%) 46.7% 53.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 499 641 355 144 278 363
Base content per 1 kb (bases) 438 562 311 126 244 318
Base content (%) 43.8% 56.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 393 563 285 108 258 305
Base content per 1 kb (bases) 411 589 298 113 270 319
Base content (%) 41.1% 58.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 358 684 280 78 289 395
Base content per 1 kb (bases) 344 656 269 75 277 379
Base content (%) 34.4% 65.6%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 145 201 105 40 96 105
Base content per 1 kb (bases) 419 581 303 116 277 303
Base content (%) 41.9% 58.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 542 836 397 145 389 447
Base content per 1 kb (bases) 393 607 288 105 282 324
Base content (%) 39.3% 60.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 110 187 73 37 95 92
Base content per 1 kb (bases) 370 630 246 125 320 310
Base content (%) 37.0% 63.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 710 1111 525 185 492 619
Base content per 1 kb (bases) 390 610 288 102 270 340
Base content (%) 39.0% 61.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 185 343 149 36 114 229
Base content per 1 kb (bases) 350 650 282 68 216 434
Base content (%) 35.0% 65.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 10 9 3 15 2 14 9 0 4 0 6 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 7 6 0 0 4 5 2 2 4 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 0 2 3 5 0 0 4 0 2 0 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 0 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 60 82 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 104 50
ATP8 (size: 198 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIIFQLKISKHNFYYNPELTTKTPKQSNPWETTWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.69%)
Threonine (Thr, T)
n = 10 (15.38%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.92%)
Isoleucine (Ile, I)
n = 5 (7.69%)
Methionine (Met, M)
n = 3 (4.62%)
Proline (Pro, P)
n = 6 (9.23%)
Phenylalanine (Phe, F)
n = 4 (6.15%)
Tyrosine (Tyr, Y)
n = 3 (4.62%)
Tryptophan (Trp, W)
n = 3 (4.62%)
Aspartic acid (Asp, D)
n = 1 (1.54%)
Glutamic acid (Glu, E)
n = 2 (3.08%)
Asparagine (Asn, N)
n = 3 (4.62%)
Glutamine (Gln, Q)
n = 3 (4.62%)
Histidine (His, H)
n = 1 (1.54%)
Lysine (Lys, K)
n = 5 (7.69%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 2 1 3 1 3 3 0 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 4 0 0 3 1 0 1 2 1 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 3 2 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 27 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 19 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 12 29 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 13 28 5 11 26 5 11 5 1 6 9 19 4 21 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 11 12 17 1 4 13 23 7 10 10 6 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 16 2 4 10 13 0 1 2 9 10 0 2 6 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 6 10 8 1 0 2 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 106 138 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 157 204 123
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 12 1 5 15 5 4 5 1 5 2 5 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 1 7 0 2 2 4 0 3 2 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 4 3 8 0 1 3 6 4 1 2 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 2 8 5 1 2 0 3 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 58 70 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 58 102 47
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 7 7 7 14 3 1 7 0 4 5 5 1 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 8 2 0 4 8 7 1 0 7 3 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 3 5 7 0 1 4 3 8 1 0 0 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 0 3 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 72 64 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 111 85 52
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 32 (8.44%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 25 15 2 20 29 3 3 5 1 1 6 10 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 5 14 0 0 10 13 1 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 2 2 6 9 1 1 2 4 11 0 0 3 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 2 9 9 0 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 103 119 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 157 167 45
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 58 (18.3%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 16 16 7 11 27 3 10 7 0 0 3 9 0 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 12 14 0 0 5 7 0 3 10 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 1 6 12 0 1 2 7 4 0 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 1 2 6 1 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 89 94 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 106 154 49
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 41 5 9 30 1 9 9 0 5 2 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 7 7 0 1 4 9 0 3 4 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 3 7 16 0 1 1 4 4 0 0 6 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 82 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 96 186 63
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 41 5 9 30 1 9 9 0 5 2 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 7 7 0 1 4 9 0 3 4 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 3 7 16 0 1 1 4 4 0 0 6 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 82 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 57 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 96 186 63
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 32 15 14 49 6 11 10 1 3 1 6 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 6 7 15 1 2 7 9 0 3 11 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 20 2 4 12 12 0 3 9 7 8 0 0 7 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 1 4 10 1 2 2 5 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 139 159 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 115 83 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 143 205 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 14 (14.29%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 11 1 3 11 2 3 2 0 2 0 4 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 3 5 0 1 1 2 0 0 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 4 3 2 0 1 0 1 3 0 2 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 29 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 27 46 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 40 (6.6%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 64 (10.56%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 62 (10.23%)
Methionine (Met, M)
n = 37 (6.11%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 32 (5.28%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 37 35 12 16 43 2 15 16 2 0 7 7 0 18 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 1 16 22 1 2 9 16 1 5 9 12 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 30 2 6 16 15 0 3 10 10 11 3 1 11 21 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 2 9 23 1 0 4 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 136 232 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 167 129 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 222 258 111
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 3 1 0 0 1 10 0 1 13 0 4 7 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 5 0 1 0 9 2 4 11 3 0 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 5 0 2 0 5 0 8 2 1 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 1 4 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 7 48 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 32 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 4 34 94
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 241 (6.35%)
Serine (Ser, S)
n = 278 (7.32%)
Threonine (Thr, T)
n = 335 (8.82%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 174 (4.58%)
Leucine (Leu, L)
n = 597 (15.72%)
Isoleucine (Ile, I)
n = 335 (8.82%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 240 (6.32%)
Tyrosine (Tyr, Y)
n = 132 (3.48%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 162 (4.27%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 94 (2.48%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
168 167 219 71 109 270 36 97 81 7 43 35 81 15 103 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 5 17 42 83 113 3 25 65 102 23 37 69 81 6 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 168 12 38 73 106 2 18 41 62 70 6 14 51 111 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 72 20 20 48 87 11 5 15 42 2 1 0 6 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
790 925 1248 835
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 988 741 1604
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
197 1198 1624 779

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.