Viewing data for Catopuma temminckii


Scientific name Catopuma temminckii
Common name Asiatic golden cat
Maximum lifespan 23.00 years (Catopuma temminckii@AnAge)

Total mtDNA (size: 16985 bases) GC AT G C A T
Base content (bases) 6750 10235 4374 2376 4670 5565
Base content per 1 kb (bases) 397 603 258 140 275 328
Base content (%) 39.7% 60.3%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4552 6787 3098 1454 3202 3585
Base content per 1 kb (bases) 401 599 273 128 282 316
Base content (%) 40.1% 59.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 532 979 303 229 440 539
Base content per 1 kb (bases) 352 648 201 152 291 357
Base content (%) 35.2% 64.8%
Total rRNA-coding genes (size: 2536 bases) GC AT G C A T
Base content (bases) 1018 1518 559 459 593 925
Base content per 1 kb (bases) 401 599 220 181 234 365
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 400 559 225 175 213 346
Base content per 1 kb (bases) 417 583 235 182 222 361
Base content (%) 41.7% 58.3%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 618 959 334 284 380 579
Base content per 1 kb (bases) 392 608 212 180 241 367
Base content (%) 39.2% 60.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 268 413 187 81 204 209
Base content per 1 kb (bases) 394 606 275 119 300 307
Base content (%) 39.4% 60.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 61 143 49 12 57 86
Base content per 1 kb (bases) 299 701 240 59 279 422
Base content (%) 29.9% 70.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 644 901 364 280 484 417
Base content per 1 kb (bases) 417 583 236 181 313 270
Base content (%) 41.7% 58.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 279 405 174 105 190 215
Base content per 1 kb (bases) 408 592 254 154 278 314
Base content (%) 40.8% 59.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 335 449 218 117 225 224
Base content per 1 kb (bases) 427 573 278 149 287 286
Base content (%) 42.7% 57.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 497 643 344 153 310 333
Base content per 1 kb (bases) 436 564 302 134 272 292
Base content (%) 43.6% 56.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 396 560 283 113 257 303
Base content per 1 kb (bases) 414 586 296 118 269 317
Base content (%) 41.4% 58.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 388 654 289 99 273 381
Base content per 1 kb (bases) 372 628 277 95 262 366
Base content (%) 37.2% 62.8%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 145 202 104 41 94 108
Base content per 1 kb (bases) 418 582 300 118 271 311
Base content (%) 41.8% 58.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 528 850 371 157 399 451
Base content per 1 kb (bases) 383 617 269 114 290 327
Base content (%) 38.3% 61.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 104 193 69 35 101 92
Base content per 1 kb (bases) 350 650 232 118 340 310
Base content (%) 35.0% 65.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 723 1098 510 213 515 583
Base content per 1 kb (bases) 397 603 280 117 283 320
Base content (%) 39.7% 60.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 208 320 153 55 112 208
Base content per 1 kb (bases) 394 606 290 104 212 394
Base content (%) 39.4% 60.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 10 4 1 21 5 10 6 3 3 2 5 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 12 2 0 1 2 8 0 1 6 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 0 2 2 5 1 3 1 1 2 0 2 6 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 3 1 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 64 78 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 63 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 60 92 60
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIMSMIMTLFIVFQLKISKYLYPSNPEPKSTITLKQLSPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 7 (10.45%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 3 2 0 5 0 1 4 1 0 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 1 0 5 1 1 0 2 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 27 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 20 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 9 39 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 35 (6.81%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 20 12 3 19 7 18 4 2 8 4 19 7 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 1 0 10 15 15 0 8 11 20 8 9 10 9 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 4 7 5 13 2 1 2 9 10 5 2 9 8 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 8 7 8 1 1 1 5 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 101 137 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 129 185 147
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 10 2 5 14 6 5 5 2 2 4 5 1 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 3 0 1 1 5 1 2 2 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 1 4 4 6 0 1 3 10 1 1 2 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 3 3 7 4 1 1 0 4 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 60 68 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 61 85 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 6 5 5 15 0 6 6 1 3 4 7 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 7 5 3 0 0 6 13 1 1 4 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 1 6 9 1 1 3 6 7 3 2 1 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 0 3 3 0 0 1 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 64 63 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 88 104 55
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 10 5 11 26 5 9 5 1 2 7 9 0 12 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 3 10 7 2 2 8 15 1 5 6 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 1 10 14 1 0 1 0 15 1 1 3 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 1 2 9 9 0 0 2 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 97 107 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 152 150 61
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 18 (5.68%)
Threonine (Thr, T)
n = 23 (7.26%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 19 16 3 13 32 1 6 5 1 2 4 10 0 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 13 10 0 0 3 9 0 5 6 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 0 1 5 10 0 1 1 6 7 0 0 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 0 3 7 0 0 1 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 88 94 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 90 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 105 152 51
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 38 4 9 24 4 9 9 0 2 3 3 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 9 8 0 1 5 8 1 3 10 6 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 0 4 7 11 1 0 1 3 6 0 1 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 1 1 15 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 149 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 61 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 106 171 54
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 38 4 9 24 4 9 9 0 2 3 3 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 9 8 0 1 5 8 1 3 10 6 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 0 4 7 11 1 0 1 3 6 0 1 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 1 1 15 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 149 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 61 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 106 171 54
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 20 27 14 13 41 7 15 8 3 1 3 12 2 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 3 17 13 0 5 4 8 1 3 12 7 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 21 1 10 2 14 0 5 5 7 11 1 1 8 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 0 0 3 13 0 2 0 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 127 160 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 120 84 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 124 207 105
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 1 10 0 3 12 2 4 2 0 1 1 4 1 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 2 4 0 2 1 1 0 1 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 3 3 2 0 0 1 2 2 0 0 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 30 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 25 44 25
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 40 (6.6%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 49 (8.09%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 21 (3.47%)
Leucine (Leu, L)
n = 91 (15.02%)
Isoleucine (Ile, I)
n = 58 (9.57%)
Methionine (Met, M)
n = 36 (5.94%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 22 (3.63%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 33 32 14 14 39 9 9 17 3 3 3 13 2 18 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 6 20 14 0 2 10 14 3 4 9 11 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 14 2 5 14 17 2 6 6 12 10 1 6 13 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 2 3 7 23 1 0 4 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 144 214 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 151 139 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 215 230 127
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 12 (6.86%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 2 2 0 1 2 8 0 0 7 1 7 8 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 6 0 2 3 13 1 5 5 2 1 1 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 3 4 0 1 2 3 2 6 3 2 5 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 1 3 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 10 45 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 34 31 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 11 36 83
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 252 (6.63%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 311 (8.19%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 591 (15.56%)
Isoleucine (Ile, I)
n = 334 (8.79%)
Methionine (Met, M)
n = 245 (6.45%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 232 (6.11%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 157 (4.13%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 104 (2.74%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
174 160 189 71 83 264 48 102 74 17 34 36 99 24 113 119
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 7 17 53 111 82 6 35 56 105 22 38 78 74 4 83
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
82 132 14 44 60 110 11 22 28 65 77 14 23 53 104 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 78 20 22 44 97 7 6 11 46 3 1 0 7 0 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
827 912 1202 859
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 982 760 1595
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
269 1123 1550 858

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.