Viewing data for Callicebus donacophilus


Scientific name Callicebus donacophilus
Common name Bolivian titi
Maximum lifespan 25.00 years (Callicebus donacophilus@AnAge)

Total mtDNA (size: 16563 bases) GC AT G C A T
Base content (bases) 6641 9922 4435 2206 4713 5209
Base content per 1 kb (bases) 401 599 268 133 285 314
Base content (%) 40.1% 59.9%
Total protein-coding genes (size: 11322 bases) GC AT G C A T
Base content (bases) 4517 6805 3166 1351 3323 3482
Base content per 1 kb (bases) 399 601 280 119 293 308
Base content (%) 39.9% 60.1%
D-loop (size: 1137 bases) GC AT G C A T
Base content (bases) 483 654 330 153 325 329
Base content per 1 kb (bases) 425 575 290 135 286 289
Base content (%) 42.5% 57.5%
Total tRNA-coding genes (size: 1501 bases) GC AT G C A T
Base content (bases) 555 946 310 245 430 516
Base content per 1 kb (bases) 370 630 207 163 286 344
Base content (%) 37.0% 63.0%
Total rRNA-coding genes (size: 2506 bases) GC AT G C A T
Base content (bases) 1037 1469 598 439 607 862
Base content per 1 kb (bases) 414 586 239 175 242 344
Base content (%) 41.4% 58.6%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 409 542 231 178 217 325
Base content per 1 kb (bases) 430 570 243 187 228 342
Base content (%) 43.0% 57.0%
16S rRNA gene (size: 1555 bases) GC AT G C A T
Base content (bases) 628 927 367 261 390 537
Base content per 1 kb (bases) 404 596 236 168 251 345
Base content (%) 40.4% 59.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 251 430 188 63 210 220
Base content per 1 kb (bases) 369 631 276 93 308 323
Base content (%) 36.9% 63.1%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 65 142 48 17 63 79
Base content per 1 kb (bases) 314 686 232 82 304 382
Base content (%) 31.4% 68.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 649 896 397 252 474 422
Base content per 1 kb (bases) 420 580 257 163 307 273
Base content (%) 42.0% 58.0%
COX2 (size: 674 bases) GC AT G C A T
Base content (bases) 273 401 177 96 197 204
Base content per 1 kb (bases) 405 595 263 142 292 303
Base content (%) 40.5% 59.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 349 435 225 124 221 214
Base content per 1 kb (bases) 445 555 287 158 282 273
Base content (%) 44.5% 55.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 474 666 330 144 343 323
Base content per 1 kb (bases) 416 584 289 126 301 283
Base content (%) 41.6% 58.4%
ND1 (size: 949 bases) GC AT G C A T
Base content (bases) 387 562 282 105 268 294
Base content per 1 kb (bases) 408 592 297 111 282 310
Base content (%) 40.8% 59.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 389 650 303 86 300 350
Base content per 1 kb (bases) 374 626 292 83 289 337
Base content (%) 37.4% 62.6%
ND3 (size: 337 bases) GC AT G C A T
Base content (bases) 120 217 87 33 103 114
Base content per 1 kb (bases) 356 644 258 98 306 338
Base content (%) 35.6% 64.4%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 554 821 400 154 405 416
Base content per 1 kb (bases) 403 597 291 112 295 303
Base content (%) 40.3% 59.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 104 193 72 32 100 93
Base content per 1 kb (bases) 350 650 242 108 337 313
Base content (%) 35.0% 65.0%
ND5 (size: 1807 bases) GC AT G C A T
Base content (bases) 714 1093 524 190 531 562
Base content per 1 kb (bases) 395 605 290 105 294 311
Base content (%) 39.5% 60.5%
ND6 (size: 543 bases) GC AT G C A T
Base content (bases) 207 336 148 59 124 212
Base content per 1 kb (bases) 381 619 273 109 228 390
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 27 (11.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 5 10 12 3 23 1 7 6 3 2 2 4 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 4 7 0 0 0 7 1 2 7 4 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 2 5 3 3 0 1 3 2 2 0 0 5 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 1 5 0 1 0 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 70 85 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 66 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 52 96 70
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDISPWPLVIMSMVVALFYTTQLKMLNFIFCPTPMSKLIKMQKHNTTWELKWTKICLPHSTSQQF*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.47%)
Serine (Ser, S)
n = 5 (7.35%)
Threonine (Thr, T)
n = 7 (10.29%)
Cysteine (Cys, C)
n = 2 (2.94%)
Valine (Val, V)
n = 3 (4.41%)
Leucine (Leu, L)
n = 8 (11.76%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 6 (8.82%)
Proline (Pro, P)
n = 6 (8.82%)
Phenylalanine (Phe, F)
n = 4 (5.88%)
Tyrosine (Tyr, Y)
n = 1 (1.47%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 1 (1.47%)
Asparagine (Asn, N)
n = 2 (2.94%)
Glutamine (Gln, Q)
n = 5 (7.35%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 6 0 0 3 0 3 5 0 2 0 0 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 1 0 1 0 0 0 0 0 0 1 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 1 0 1 4 0 0 0 1 0 0 2 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 26 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 19 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 13 34 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.75%)
Alanine (Ala, A)
n = 37 (7.2%)
Serine (Ser, S)
n = 36 (7.0%)
Threonine (Thr, T)
n = 36 (7.0%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 32 (6.23%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 41 (7.98%)
Tyrosine (Tyr, Y)
n = 21 (4.09%)
Tryptophan (Trp, W)
n = 16 (3.11%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 11 29 10 13 25 6 6 6 1 8 6 19 3 23 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 10 12 13 2 10 11 15 9 9 10 7 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 1 6 9 14 2 2 3 6 15 2 0 10 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 8 7 10 0 1 3 3 1 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
143 115 141 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 132 99 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 150 182 149
COX2 (size: 674 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.59%)
Alanine (Ala, A)
n = 18 (8.07%)
Serine (Ser, S)
n = 18 (8.07%)
Threonine (Thr, T)
n = 11 (4.93%)
Cysteine (Cys, C)
n = 2 (0.9%)
Valine (Val, V)
n = 8 (3.59%)
Leucine (Leu, L)
n = 28 (12.56%)
Isoleucine (Ile, I)
n = 24 (10.76%)
Methionine (Met, M)
n = 13 (5.83%)
Proline (Pro, P)
n = 12 (5.38%)
Phenylalanine (Phe, F)
n = 11 (4.93%)
Tyrosine (Tyr, Y)
n = 11 (4.93%)
Tryptophan (Trp, W)
n = 5 (2.24%)
Aspartic acid (Asp, D)
n = 10 (4.48%)
Glutamic acid (Glu, E)
n = 14 (6.28%)
Asparagine (Asn, N)
n = 6 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.59%)
Histidine (His, H)
n = 7 (3.14%)
Lysine (Lys, K)
n = 4 (1.79%)
Arginine (Arg, R)
n = 6 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 10 10 1 11 1 4 7 1 3 1 4 0 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 11 5 0 2 3 2 1 5 1 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 2 4 7 1 0 4 7 4 0 1 3 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 4 2 8 4 0 1 3 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 56 62 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 66 81 64
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 9 8 3 10 1 2 8 1 2 6 4 0 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 5 9 8 0 3 8 7 2 2 5 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 3 7 1 0 5 8 5 1 3 2 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 3 2 1 0 0 1 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 64 61 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 58 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 92 95 60
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 31 (8.18%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 11 11 10 10 28 5 7 7 1 2 1 10 1 14 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 8 10 7 0 5 10 7 2 2 8 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 1 3 14 8 0 1 2 3 11 4 0 6 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 3 8 8 3 1 1 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 100 115 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 102 75 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 128 133 100
ND1 (size: 949 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.49%)
Alanine (Ala, A)
n = 32 (10.16%)
Serine (Ser, S)
n = 20 (6.35%)
Threonine (Thr, T)
n = 28 (8.89%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 10 (3.17%)
Leucine (Leu, L)
n = 62 (19.68%)
Isoleucine (Ile, I)
n = 24 (7.62%)
Methionine (Met, M)
n = 18 (5.71%)
Proline (Pro, P)
n = 21 (6.67%)
Phenylalanine (Phe, F)
n = 18 (5.71%)
Tyrosine (Tyr, Y)
n = 13 (4.13%)
Tryptophan (Trp, W)
n = 9 (2.86%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.49%)
Asparagine (Asn, N)
n = 11 (3.49%)
Glutamine (Gln, Q)
n = 6 (1.9%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 8 (2.54%)
Arginine (Arg, R)
n = 7 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 18 7 16 22 3 13 6 0 3 3 4 0 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 2 14 15 1 1 7 2 1 5 10 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 1 2 4 12 0 1 1 7 6 1 1 6 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 0 3 8 0 2 0 5 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 85 91 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 99 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 98 148 62
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 37 (10.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 31 (8.99%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 17 (4.93%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 15 29 9 11 28 0 10 9 2 6 1 3 2 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 9 6 0 1 5 5 1 5 10 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 0 3 12 8 0 1 5 6 4 1 0 6 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 0 10 0 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 92 137 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 103 60 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 108 153 77
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 37 (10.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 31 (8.99%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 17 (4.93%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 15 29 9 11 28 0 10 9 2 6 1 3 2 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 9 6 0 1 5 5 1 5 10 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 0 3 12 8 0 1 5 6 4 1 0 6 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 0 10 0 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 92 137 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 103 60 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 108 153 77
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.94%)
Alanine (Ala, A)
n = 27 (5.91%)
Serine (Ser, S)
n = 39 (8.53%)
Threonine (Thr, T)
n = 44 (9.63%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 97 (21.23%)
Isoleucine (Ile, I)
n = 37 (8.1%)
Methionine (Met, M)
n = 34 (7.44%)
Proline (Pro, P)
n = 27 (5.91%)
Phenylalanine (Phe, F)
n = 20 (4.38%)
Tyrosine (Tyr, Y)
n = 17 (3.72%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 19 (4.16%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 12 28 19 14 40 8 14 7 1 4 4 5 0 11 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 3 4 15 7 1 2 5 8 3 4 14 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 4 6 9 12 0 2 10 9 8 0 2 10 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 1 0 2 10 1 1 3 7 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 135 157 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 125 74 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 140 185 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 5 (5.1%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 10 1 1 15 1 8 2 0 1 1 1 1 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 0 4 3 0 1 2 1 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 2 3 2 0 0 0 3 2 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 25 27 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 20 18 53
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 27 48 18
ND5 (size: 1807 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.49%)
Alanine (Ala, A)
n = 41 (6.82%)
Serine (Ser, S)
n = 54 (8.99%)
Threonine (Thr, T)
n = 59 (9.82%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 93 (15.47%)
Isoleucine (Ile, I)
n = 56 (9.32%)
Methionine (Met, M)
n = 41 (6.82%)
Proline (Pro, P)
n = 30 (4.99%)
Phenylalanine (Phe, F)
n = 46 (7.65%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 9 (1.5%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 33 (5.49%)
Glutamine (Gln, Q)
n = 17 (2.83%)
Histidine (His, H)
n = 12 (2.0%)
Lysine (Lys, K)
n = 18 (3.0%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 24 36 24 11 42 5 11 15 2 5 1 8 1 23 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 10 17 14 0 2 13 11 1 6 13 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 20 2 10 11 17 1 4 11 6 11 2 0 13 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 4 5 15 3 0 5 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 150 222 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 169 116 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 205 224 151
ND6 (size: 543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.44%)
Alanine (Ala, A)
n = 11 (6.11%)
Serine (Ser, S)
n = 11 (6.11%)
Threonine (Thr, T)
n = 13 (7.22%)
Cysteine (Cys, C)
n = 2 (1.11%)
Valine (Val, V)
n = 19 (10.56%)
Leucine (Leu, L)
n = 21 (11.67%)
Isoleucine (Ile, I)
n = 12 (6.67%)
Methionine (Met, M)
n = 15 (8.33%)
Proline (Pro, P)
n = 6 (3.33%)
Phenylalanine (Phe, F)
n = 9 (5.0%)
Tyrosine (Tyr, Y)
n = 10 (5.56%)
Tryptophan (Trp, W)
n = 4 (2.22%)
Aspartic acid (Asp, D)
n = 4 (2.22%)
Glutamic acid (Glu, E)
n = 8 (4.44%)
Asparagine (Asn, N)
n = 2 (1.11%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.11%)
Lysine (Lys, K)
n = 3 (1.67%)
Arginine (Arg, R)
n = 2 (1.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 1 9 1 0 2 1 10 0 0 10 0 5 4 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 6 0 3 2 10 3 6 7 6 0 0 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 3 0 4 0 3 1 9 1 4 7 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 0 3 1 0 1 0 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 14 49 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 37 30 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 8 45 86
Total protein-coding genes (size: 11378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.44%)
Alanine (Ala, A)
n = 262 (6.91%)
Serine (Ser, S)
n = 283 (7.47%)
Threonine (Thr, T)
n = 333 (8.79%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 157 (4.14%)
Leucine (Leu, L)
n = 608 (16.05%)
Isoleucine (Ile, I)
n = 335 (8.84%)
Methionine (Met, M)
n = 242 (6.39%)
Proline (Pro, P)
n = 210 (5.54%)
Phenylalanine (Phe, F)
n = 239 (6.31%)
Tyrosine (Tyr, Y)
n = 139 (3.67%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 88 (2.32%)
Asparagine (Asn, N)
n = 151 (3.99%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 94 (2.48%)
Lysine (Lys, K)
n = 91 (2.4%)
Arginine (Arg, R)
n = 62 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
223 112 209 113 87 259 32 99 81 12 48 26 70 13 130 109
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 9 13 55 111 90 6 37 67 73 29 49 84 75 2 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
111 143 14 45 74 98 5 15 46 68 71 15 18 68 83 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 73 15 28 38 80 11 8 19 32 3 0 0 3 2 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
779 950 1213 848
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
455 1027 727 1581
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
210 1115 1474 991

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.