Viewing data for Carcharhinus brevipinna


Scientific name Carcharhinus brevipinna
Common name Spinner shark
Maximum lifespan 19.00 years (Carcharhinus brevipinna@AnAge)

Total mtDNA (size: 16706 bases) GC AT G C A T
Base content (bases) 6436 10270 4224 2212 5033 5237
Base content per 1 kb (bases) 385 615 253 132 301 313
Base content (%) 38.5% 61.5%
Total protein-coding genes (size: 11407 bases) GC AT G C A T
Base content (bases) 4421 6986 3094 1327 3526 3460
Base content per 1 kb (bases) 388 612 271 116 309 303
Base content (%) 38.8% 61.2%
D-loop (size: 1068 bases) GC AT G C A T
Base content (bases) 354 714 208 146 375 339
Base content per 1 kb (bases) 331 669 195 137 351 317
Base content (%) 33.1% 66.9%
Total tRNA-coding genes (size: 1549 bases) GC AT G C A T
Base content (bases) 615 934 342 273 434 500
Base content per 1 kb (bases) 397 603 221 176 280 323
Base content (%) 39.7% 60.3%
Total rRNA-coding genes (size: 2626 bases) GC AT G C A T
Base content (bases) 1023 1603 566 457 680 923
Base content per 1 kb (bases) 390 610 216 174 259 351
Base content (%) 39.0% 61.0%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 404 552 226 178 229 323
Base content per 1 kb (bases) 423 577 236 186 240 338
Base content (%) 42.3% 57.7%
16S rRNA gene (size: 1670 bases) GC AT G C A T
Base content (bases) 619 1051 340 279 451 600
Base content per 1 kb (bases) 371 629 204 167 270 359
Base content (%) 37.1% 62.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 245 439 179 66 221 218
Base content per 1 kb (bases) 358 642 262 96 323 319
Base content (%) 35.8% 64.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 49 119 40 9 53 66
Base content per 1 kb (bases) 292 708 238 54 315 393
Base content (%) 29.2% 70.8%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 598 959 357 241 535 424
Base content per 1 kb (bases) 384 616 229 155 344 272
Base content (%) 38.4% 61.6%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 261 430 161 100 208 222
Base content per 1 kb (bases) 378 622 233 145 301 321
Base content (%) 37.8% 62.2%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 326 460 204 122 240 220
Base content per 1 kb (bases) 415 585 260 155 305 280
Base content (%) 41.5% 58.5%
CYTB (size: 1145 bases) GC AT G C A T
Base content (bases) 466 679 328 138 357 322
Base content per 1 kb (bases) 407 593 286 121 312 281
Base content (%) 40.7% 59.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 377 598 269 108 307 291
Base content per 1 kb (bases) 387 613 276 111 315 298
Base content (%) 38.7% 61.3%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 405 640 312 93 307 333
Base content per 1 kb (bases) 388 612 299 89 294 319
Base content (%) 38.8% 61.2%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 145 204 96 49 112 92
Base content per 1 kb (bases) 415 585 275 140 321 264
Base content (%) 41.5% 58.5%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 529 852 385 144 433 419
Base content per 1 kb (bases) 383 617 279 104 314 303
Base content (%) 38.3% 61.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 123 174 89 34 99 75
Base content per 1 kb (bases) 414 586 300 114 333 253
Base content (%) 41.4% 58.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 700 1130 517 183 559 571
Base content per 1 kb (bases) 383 617 283 100 305 312
Base content (%) 38.3% 61.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 201 321 159 42 103 218
Base content per 1 kb (bases) 385 615 305 80 197 418
Base content (%) 38.5% 61.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 25 (11.01%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 7 9 11 6 16 0 20 9 0 2 2 6 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 4 8 0 2 2 5 0 3 1 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 2 0 1 0 1 3 3 1 0 0 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 1 0 0 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 66 74 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 33 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 52 111 64
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLILLFSWIIFLTILPNKIMNHLFNNDPTLKSTEKPKPNPWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 1 1 0 3 0 5 1 0 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 4 1 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 0 0 1 0 0 1 0 0 0 0 4 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 15 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 13 17 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 12 26 17
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.69%)
Alanine (Ala, A)
n = 44 (8.49%)
Serine (Ser, S)
n = 32 (6.18%)
Threonine (Thr, T)
n = 33 (6.37%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 65 (12.55%)
Isoleucine (Ile, I)
n = 43 (8.3%)
Methionine (Met, M)
n = 24 (4.63%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 40 (7.72%)
Tyrosine (Tyr, Y)
n = 18 (3.47%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 10 (1.93%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 13 20 26 7 12 2 18 9 1 15 5 18 1 24 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 12 12 20 0 19 7 16 3 11 3 17 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 10 4 14 0 1 3 13 5 0 0 7 8 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 0 10 5 8 0 2 0 6 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 116 127 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 105 201 201
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 10 4 3 9 0 8 9 0 6 5 7 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 6 5 0 3 3 3 0 6 1 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 3 2 8 0 2 1 6 4 0 1 4 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 16 0 5 7 4 0 3 0 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 54 58 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 65 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 52 99 75
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 21 (8.05%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 22 (8.43%)
Tyrosine (Tyr, Y)
n = 13 (4.98%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 7 10 7 4 0 12 8 0 8 2 8 0 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 4 9 9 0 5 5 11 0 3 3 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 0 3 6 1 0 3 10 3 1 0 2 1 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 2 3 2 0 2 0 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 63 51 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 58 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 75 111 73
CYTB (size: 1145 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 19 (5.0%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 60 (15.79%)
Isoleucine (Ile, I)
n = 38 (10.0%)
Methionine (Met, M)
n = 14 (3.68%)
Proline (Pro, P)
n = 21 (5.53%)
Phenylalanine (Phe, F)
n = 35 (9.21%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 13 12 12 21 1 14 8 1 5 8 6 0 8 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 7 13 6 0 2 8 12 1 5 4 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 5 8 7 1 1 2 5 9 0 0 6 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 3 6 9 0 1 3 4 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 95 103 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 87 78 166
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 146 140 90
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 25 (7.72%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 23 (7.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.78%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 31 (9.57%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 16 14 10 14 19 0 22 6 1 3 2 3 1 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 7 9 9 0 6 2 8 2 9 6 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 3 3 12 0 1 3 9 4 0 0 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 0 2 1 7 0 2 2 4 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 86 92 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 90 57 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 93 142 85
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 78 (22.48%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 12 (3.46%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 11 13 17 28 0 19 9 0 0 1 3 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 8 9 7 0 2 4 12 0 6 7 9 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 0 4 5 16 0 4 0 2 5 0 1 3 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 10 0 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 100 119 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 114 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 98 159 89
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 78 (22.48%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 12 (3.46%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 11 13 17 28 0 19 9 0 0 1 3 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 8 9 7 0 2 4 12 0 6 7 9 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 0 4 5 16 0 4 0 2 5 0 1 3 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 10 0 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 100 119 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 114 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 98 159 89
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.36%)
Alanine (Ala, A)
n = 32 (6.97%)
Serine (Ser, S)
n = 38 (8.28%)
Threonine (Thr, T)
n = 37 (8.06%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 9 (1.96%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 51 (11.11%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 23 (5.01%)
Phenylalanine (Phe, F)
n = 23 (5.01%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 14 (3.05%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 21 23 21 22 23 0 19 12 0 2 3 4 0 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 11 12 9 0 2 8 8 2 4 5 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 0 11 9 9 0 5 4 6 7 0 0 4 13 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 0 3 2 11 0 0 2 9 0 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 126 150 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 121 82 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 138 187 131
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 6 4 5 5 0 5 2 0 0 1 0 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 5 2 3 0 1 3 1 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 4 5 3 0 1 2 1 0 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 1 0 2 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 22 29 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 36 32 30
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 39 (6.4%)
Serine (Ser, S)
n = 53 (8.7%)
Threonine (Thr, T)
n = 50 (8.21%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 18 (2.96%)
Leucine (Leu, L)
n = 106 (17.41%)
Isoleucine (Ile, I)
n = 63 (10.34%)
Methionine (Met, M)
n = 23 (3.78%)
Proline (Pro, P)
n = 29 (4.76%)
Phenylalanine (Phe, F)
n = 41 (6.73%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 17 (2.79%)
Histidine (His, H)
n = 16 (2.63%)
Lysine (Lys, K)
n = 26 (4.27%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
36 27 22 20 29 28 1 26 17 0 7 3 8 0 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 3 13 16 10 0 11 6 11 0 8 10 11 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 5 15 20 0 6 7 6 7 1 2 11 24 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 5 8 26 0 1 3 5 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 149 210 142
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 158 132 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 210 229 166
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 13 (7.51%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 8 (4.62%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 4 1 0 1 0 17 0 0 10 0 9 3 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 8 0 2 3 10 1 8 8 3 0 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 1 1 2 0 10 0 2 12 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 3 4 0 1 0 0 0 1 2 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 11 26 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 29 24 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 2 53 74
Total protein-coding genes (size: 11430 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 229 (6.02%)
Alanine (Ala, A)
n = 278 (7.3%)
Serine (Ser, S)
n = 268 (7.04%)
Threonine (Thr, T)
n = 284 (7.46%)
Cysteine (Cys, C)
n = 23 (0.6%)
Valine (Val, V)
n = 169 (4.44%)
Leucine (Leu, L)
n = 660 (17.34%)
Isoleucine (Ile, I)
n = 345 (9.06%)
Methionine (Met, M)
n = 168 (4.41%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 243 (6.38%)
Tyrosine (Tyr, Y)
n = 118 (3.1%)
Tryptophan (Trp, W)
n = 123 (3.23%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 149 (3.91%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 104 (2.73%)
Lysine (Lys, K)
n = 85 (2.23%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
200 145 140 137 129 177 5 196 92 3 58 33 73 5 109 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
28 14 9 87 95 92 4 64 49 100 16 65 43 105 2 82
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
82 119 1 54 57 99 4 24 30 72 46 4 16 52 97 49
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
55 94 4 38 35 85 0 14 14 42 3 0 1 7 0 119
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
847 935 1086 940
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
503 991 729 1585
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
96 1053 1540 1119

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.