Viewing data for Macaca fuscata


Scientific name Macaca fuscata
Common name Japanese macaque
Maximum lifespan 38.50 years (Macaca fuscata@AnAge)

Total mtDNA (size: 16565 bases) GC AT G C A T
Base content (bases) 7196 9369 5060 2136 4119 5250
Base content per 1 kb (bases) 434 566 305 129 249 317
Base content (%) 43.4% 56.6%
Total protein-coding genes (size: 11370 bases) GC AT G C A T
Base content (bases) 4970 6400 3672 1298 2885 3515
Base content per 1 kb (bases) 437 563 323 114 254 309
Base content (%) 43.7% 56.3%
D-loop (size: 1088 bases) GC AT G C A T
Base content (bases) 486 602 345 141 282 320
Base content per 1 kb (bases) 447 553 317 130 259 294
Base content (%) 44.7% 55.3%
Total tRNA-coding genes (size: 1499 bases) GC AT G C A T
Base content (bases) 603 896 370 233 379 517
Base content per 1 kb (bases) 402 598 247 155 253 345
Base content (%) 40.2% 59.8%
Total rRNA-coding genes (size: 2503 bases) GC AT G C A T
Base content (bases) 1087 1416 627 460 552 864
Base content per 1 kb (bases) 434 566 250 184 221 345
Base content (%) 43.4% 56.6%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 424 522 236 188 215 307
Base content per 1 kb (bases) 448 552 249 199 227 325
Base content (%) 44.8% 55.2%
16S rRNA gene (size: 1557 bases) GC AT G C A T
Base content (bases) 663 894 391 272 337 557
Base content per 1 kb (bases) 426 574 251 175 216 358
Base content (%) 42.6% 57.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 294 387 224 70 169 218
Base content per 1 kb (bases) 432 568 329 103 248 320
Base content (%) 43.2% 56.8%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 85 122 69 16 48 74
Base content per 1 kb (bases) 411 589 333 77 232 357
Base content (%) 41.1% 58.9%
COX1 (size: 1569 bases) GC AT G C A T
Base content (bases) 703 866 445 258 451 415
Base content per 1 kb (bases) 448 552 284 164 287 264
Base content (%) 44.8% 55.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 301 383 199 102 174 209
Base content per 1 kb (bases) 440 560 291 149 254 306
Base content (%) 44.0% 56.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 352 432 249 103 211 221
Base content per 1 kb (bases) 449 551 318 131 269 282
Base content (%) 44.9% 55.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 518 623 385 133 287 336
Base content per 1 kb (bases) 454 546 337 117 252 294
Base content (%) 45.4% 54.6%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 439 516 331 108 230 286
Base content per 1 kb (bases) 460 540 347 113 241 299
Base content (%) 46.0% 54.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 437 605 352 85 253 352
Base content per 1 kb (bases) 419 581 338 82 243 338
Base content (%) 41.9% 58.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 145 201 107 38 92 109
Base content per 1 kb (bases) 419 581 309 110 266 315
Base content (%) 41.9% 58.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 585 793 454 131 359 434
Base content per 1 kb (bases) 425 575 329 95 261 315
Base content (%) 42.5% 57.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 91 34 88 84
Base content per 1 kb (bases) 421 579 306 114 296 283
Base content (%) 42.1% 57.9%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 787 1025 601 186 445 580
Base content per 1 kb (bases) 434 566 332 103 246 320
Base content (%) 43.4% 56.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 217 311 179 38 94 217
Base content per 1 kb (bases) 411 589 339 72 178 411
Base content (%) 41.1% 58.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 14 (6.19%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 11 6 5 24 4 6 9 0 0 2 7 3 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 6 7 0 0 3 3 1 2 8 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 8 0 1 6 2 1 0 2 1 2 0 1 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 5 0 0 1 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 72 81 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 72 42 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 80 95 40
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWFTIIMTMLPTLYLIMQLKLLNTNHYQPPLTKNPTLQSHNIRWQPKWTKTCLPLSQPQQF*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (4.41%)
Threonine (Thr, T)
n = 10 (14.71%)
Cysteine (Cys, C)
n = 1 (1.47%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.18%)
Isoleucine (Ile, I)
n = 4 (5.88%)
Methionine (Met, M)
n = 4 (5.88%)
Proline (Pro, P)
n = 8 (11.76%)
Phenylalanine (Phe, F)
n = 2 (2.94%)
Tyrosine (Tyr, Y)
n = 2 (2.94%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (5.88%)
Glutamine (Gln, Q)
n = 8 (11.76%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 4 (5.88%)
Arginine (Arg, R)
n = 1 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 5 0 4 0 2 6 2 0 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 0 0 0 0 0 0 0 0 2 4 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 3 1 1 0 1 0 0 0 2 0 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 1 0 3 1 0 1 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 28 26 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 21 22 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 20 26 13
COX1 (size: 1569 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 49 (9.39%)
Alanine (Ala, A)
n = 39 (7.47%)
Serine (Ser, S)
n = 31 (5.94%)
Threonine (Thr, T)
n = 33 (6.32%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 35 (6.7%)
Leucine (Leu, L)
n = 64 (12.26%)
Isoleucine (Ile, I)
n = 45 (8.62%)
Methionine (Met, M)
n = 28 (5.36%)
Proline (Pro, P)
n = 31 (5.94%)
Phenylalanine (Phe, F)
n = 41 (7.85%)
Tyrosine (Tyr, Y)
n = 20 (3.83%)
Tryptophan (Trp, W)
n = 16 (3.07%)
Aspartic acid (Asp, D)
n = 14 (2.68%)
Glutamic acid (Glu, E)
n = 9 (1.72%)
Asparagine (Asn, N)
n = 19 (3.64%)
Glutamine (Gln, Q)
n = 7 (1.34%)
Histidine (His, H)
n = 18 (3.45%)
Lysine (Lys, K)
n = 12 (2.3%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 25 21 6 12 30 5 10 7 0 8 8 15 4 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 11 16 12 0 8 19 13 9 6 18 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 1 10 8 9 0 1 3 8 12 3 1 6 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 4 10 12 0 2 3 3 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 118 141 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 130 100 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 197 174 120
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 8 2 5 16 4 5 7 0 5 4 3 2 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 6 4 0 0 4 5 1 4 3 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 2 4 2 3 1 0 4 3 6 0 0 4 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 1 9 4 0 1 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 62 67 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 61 55 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 76 87 47
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 12 (4.62%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 7 3 9 15 2 6 7 1 5 3 4 1 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 5 4 3 0 1 10 7 0 1 7 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 0 5 3 6 0 1 3 5 7 1 0 1 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 0 3 1 3 0 1 1 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 71 69 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 67 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 111 96 45
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.54%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 32 (8.44%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 12 (3.17%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 22 (5.8%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 10 (2.64%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 16 10 18 30 3 5 8 0 2 4 5 1 4 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 10 10 0 2 11 6 2 1 10 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 0 1 12 9 1 0 4 4 11 5 0 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 2 8 10 0 0 4 4 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 112 119 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 101 75 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 172 142 50
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 34 (10.73%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 10 (3.15%)
Leucine (Leu, L)
n = 62 (19.56%)
Isoleucine (Ile, I)
n = 20 (6.31%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 8 (2.52%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 14 (4.42%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 17 5 19 28 4 6 6 0 3 4 3 0 2 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 16 10 0 2 5 3 2 2 14 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 1 1 6 11 0 0 3 1 7 0 0 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 1 2 1 7 0 1 0 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 94 96 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 101 54 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 136 136 36
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 15 (4.34%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 51 (14.74%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 26 (7.51%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 26 22 10 14 32 2 4 10 0 1 1 1 2 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 6 6 0 5 3 5 1 2 11 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 0 6 10 7 0 1 5 2 8 0 1 1 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 0 9 1 0 4 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 102 146 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 111 60 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 139 146 51
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 15 (4.34%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 51 (14.74%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 26 (7.51%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 26 22 10 14 32 2 4 10 0 1 1 1 2 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 6 6 0 5 3 5 1 2 11 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 0 6 10 7 0 1 5 2 8 0 1 1 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 0 9 1 0 4 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 102 146 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 111 60 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 139 146 51
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 25 (5.46%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 56 (12.23%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 28 16 22 39 4 10 9 1 0 2 5 0 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 2 11 10 2 1 9 4 2 1 19 4 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 26 1 7 12 6 0 2 8 5 9 2 1 6 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 2 1 9 3 1 2 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 138 175 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 130 86 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 186 173 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 10 (10.2%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 7 7 5 3 9 1 1 1 0 1 0 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 7 2 0 1 1 2 0 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 2 1 3 1 0 0 0 4 0 2 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 25 32 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 25 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 41 34 18
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.15%)
Alanine (Ala, A)
n = 42 (6.97%)
Serine (Ser, S)
n = 44 (7.3%)
Threonine (Thr, T)
n = 66 (10.95%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 96 (15.92%)
Isoleucine (Ile, I)
n = 57 (9.45%)
Methionine (Met, M)
n = 40 (6.63%)
Proline (Pro, P)
n = 32 (5.31%)
Phenylalanine (Phe, F)
n = 37 (6.14%)
Tyrosine (Tyr, Y)
n = 17 (2.82%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 12 (1.99%)
Glutamic acid (Glu, E)
n = 9 (1.49%)
Asparagine (Asn, N)
n = 34 (5.64%)
Glutamine (Gln, Q)
n = 20 (3.32%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.65%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 37 34 13 30 41 3 9 20 0 2 1 8 0 9 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 5 6 24 12 0 2 13 8 2 3 16 13 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 22 4 4 12 14 3 0 11 5 12 3 0 5 29 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 2 10 21 1 2 4 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 159 230 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 173 126 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 269 224 88
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 6 (3.43%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 30 (17.14%)
Leucine (Leu, L)
n = 22 (12.57%)
Isoleucine (Ile, I)
n = 11 (6.29%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 9 (5.14%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 3 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 0 2 1 0 2 2 10 0 0 15 0 6 9 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 4 0 2 3 14 1 3 10 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 5 0 1 0 6 0 8 1 3 7 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 5 0 0 1 1 0 1 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 11 36 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 24 25 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 3 33 87
Total protein-coding genes (size: 11424 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.41%)
Alanine (Ala, A)
n = 242 (6.36%)
Serine (Ser, S)
n = 259 (6.81%)
Threonine (Thr, T)
n = 384 (10.09%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 155 (4.07%)
Leucine (Leu, L)
n = 633 (16.64%)
Isoleucine (Ile, I)
n = 330 (8.67%)
Methionine (Met, M)
n = 225 (5.91%)
Proline (Pro, P)
n = 217 (5.7%)
Phenylalanine (Phe, F)
n = 215 (5.65%)
Tyrosine (Tyr, Y)
n = 126 (3.31%)
Tryptophan (Trp, W)
n = 102 (2.68%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 83 (2.18%)
Asparagine (Asn, N)
n = 168 (4.42%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 101 (2.65%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 66 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
131 199 179 82 140 287 35 76 92 5 43 29 60 23 67 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 8 21 46 113 78 5 36 79 60 31 28 116 67 6 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
151 165 13 47 74 73 9 12 44 44 82 17 13 32 136 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 69 14 23 44 86 8 9 24 29 4 0 1 6 0 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
753 1025 1258 770
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
460 1046 742 1558
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
230 1474 1412 690

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.