Viewing data for Trichosurus vulpecula


Scientific name Trichosurus vulpecula
Common name Brush-tailed possum
Maximum lifespan 15.90 years (Trichosurus vulpecula@AnAge)

Total mtDNA (size: 17191 bases) GC AT G C A T
Base content (bases) 6418 10773 4347 2071 4799 5974
Base content per 1 kb (bases) 373 627 253 120 279 348
Base content (%) 37.3% 62.7%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4444 6906 3201 1243 3129 3777
Base content per 1 kb (bases) 392 608 282 110 276 333
Base content (%) 39.2% 60.8%
D-loop (size: 1754 bases) GC AT G C A T
Base content (bases) 457 1297 262 195 623 674
Base content per 1 kb (bases) 261 739 149 111 355 384
Base content (%) 26.1% 73.9%
Total tRNA-coding genes (size: 1502 bases) GC AT G C A T
Base content (bases) 507 995 302 205 449 546
Base content per 1 kb (bases) 338 662 201 136 299 364
Base content (%) 33.8% 66.2%
Total rRNA-coding genes (size: 2511 bases) GC AT G C A T
Base content (bases) 965 1546 550 415 585 961
Base content per 1 kb (bases) 384 616 219 165 233 383
Base content (%) 38.4% 61.6%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 382 564 215 167 208 356
Base content per 1 kb (bases) 404 596 227 177 220 376
Base content (%) 40.4% 59.6%
16S rRNA gene (size: 1565 bases) GC AT G C A T
Base content (bases) 583 982 335 248 377 605
Base content per 1 kb (bases) 373 627 214 158 241 387
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 255 426 194 61 193 233
Base content per 1 kb (bases) 374 626 285 90 283 342
Base content (%) 37.4% 62.6%
ATP8 (size: 210 bases) GC AT G C A T
Base content (bases) 71 139 57 14 52 87
Base content per 1 kb (bases) 338 662 271 67 248 414
Base content (%) 33.8% 66.2%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 594 954 363 231 490 464
Base content per 1 kb (bases) 384 616 234 149 317 300
Base content (%) 38.4% 61.6%
COX2 (size: 693 bases) GC AT G C A T
Base content (bases) 260 433 170 90 194 239
Base content per 1 kb (bases) 375 625 245 130 280 345
Base content (%) 37.5% 62.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 314 470 200 114 237 233
Base content per 1 kb (bases) 401 599 255 145 302 297
Base content (%) 40.1% 59.9%
CYTB (size: 1146 bases) GC AT G C A T
Base content (bases) 486 660 350 136 299 361
Base content per 1 kb (bases) 424 576 305 119 261 315
Base content (%) 42.4% 57.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 378 579 270 108 275 304
Base content per 1 kb (bases) 395 605 282 113 287 318
Base content (%) 39.5% 60.5%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 412 632 334 78 266 366
Base content per 1 kb (bases) 395 605 320 75 255 351
Base content (%) 39.5% 60.5%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 140 208 100 40 106 102
Base content per 1 kb (bases) 402 598 287 115 305 293
Base content (%) 40.2% 59.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 554 824 421 133 379 445
Base content per 1 kb (bases) 402 598 306 97 275 323
Base content (%) 40.2% 59.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 118 179 83 35 82 97
Base content per 1 kb (bases) 397 603 279 118 276 327
Base content (%) 39.7% 60.3%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 710 1108 537 173 476 632
Base content per 1 kb (bases) 391 609 295 95 262 348
Base content (%) 39.1% 60.9%
ND6 (size: 504 bases) GC AT G C A T
Base content (bases) 171 333 136 35 97 236
Base content per 1 kb (bases) 339 661 270 69 192 468
Base content (%) 33.9% 66.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 13 (5.75%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 30 (13.27%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.65%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 29 (12.83%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 13 12 6 3 23 2 7 8 0 1 0 5 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 6 4 0 3 3 2 1 2 2 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 2 3 5 0 0 2 2 1 0 1 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 4 1 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
32 67 90 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 36 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 60 107 53
ATP8 (size: 210 bases)
Amino acid sequence: MPQLDTSTWFLTISLMIISLFCVYQTKMINQTMISITQQNKKDITSQTQLHWEKKWTKIYLPHSSPLLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.59%)
Threonine (Thr, T)
n = 9 (13.04%)
Cysteine (Cys, C)
n = 1 (1.45%)
Valine (Val, V)
n = 1 (1.45%)
Leucine (Leu, L)
n = 8 (11.59%)
Isoleucine (Ile, I)
n = 8 (11.59%)
Methionine (Met, M)
n = 4 (5.8%)
Proline (Pro, P)
n = 3 (4.35%)
Phenylalanine (Phe, F)
n = 2 (2.9%)
Tyrosine (Tyr, Y)
n = 2 (2.9%)
Tryptophan (Trp, W)
n = 3 (4.35%)
Aspartic acid (Asp, D)
n = 2 (2.9%)
Glutamic acid (Glu, E)
n = 1 (1.45%)
Asparagine (Asn, N)
n = 2 (2.9%)
Glutamine (Gln, Q)
n = 7 (10.14%)
Histidine (His, H)
n = 2 (2.9%)
Lysine (Lys, K)
n = 6 (8.7%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 6 3 1 1 4 0 1 7 0 0 0 0 1 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 0 0 0 0 0 0 0 0 1 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 0 2 6 0 0 0 1 1 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 2 0 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 29 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 23 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 19 35 10
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 41 (7.96%)
Serine (Ser, S)
n = 32 (6.21%)
Threonine (Thr, T)
n = 37 (7.18%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.8%)
Leucine (Leu, L)
n = 60 (11.65%)
Isoleucine (Ile, I)
n = 44 (8.54%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 28 (5.44%)
Phenylalanine (Phe, F)
n = 43 (8.35%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 17 (3.3%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 20 27 20 2 20 0 18 8 0 7 6 21 1 19 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 9 15 17 0 9 10 26 2 5 2 20 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 7 5 16 1 3 0 10 9 0 0 8 8 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 1 8 7 9 0 1 1 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 103 138 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 125 232 151
COX2 (size: 693 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.48%)
Alanine (Ala, A)
n = 11 (4.78%)
Serine (Ser, S)
n = 17 (7.39%)
Threonine (Thr, T)
n = 19 (8.26%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 12 (5.22%)
Leucine (Leu, L)
n = 30 (13.04%)
Isoleucine (Ile, I)
n = 17 (7.39%)
Methionine (Met, M)
n = 19 (8.26%)
Proline (Pro, P)
n = 14 (6.09%)
Phenylalanine (Phe, F)
n = 9 (3.91%)
Tyrosine (Tyr, Y)
n = 13 (5.65%)
Tryptophan (Trp, W)
n = 5 (2.17%)
Aspartic acid (Asp, D)
n = 11 (4.78%)
Glutamic acid (Glu, E)
n = 13 (5.65%)
Asparagine (Asn, N)
n = 4 (1.74%)
Glutamine (Gln, Q)
n = 9 (3.91%)
Histidine (His, H)
n = 6 (2.61%)
Lysine (Lys, K)
n = 5 (2.17%)
Arginine (Arg, R)
n = 6 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 15 2 2 17 2 6 9 0 3 2 6 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 4 6 1 0 1 4 3 0 2 5 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 11 0 2 3 8 0 3 1 8 5 1 1 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 0 5 6 5 0 1 2 3 0 1 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 58 69 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 57 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 55 109 58
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 8 5 5 14 1 9 8 0 1 1 7 4 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 10 4 0 1 9 8 3 2 2 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 15 0 0 3 15 0 2 1 8 4 0 0 5 1 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 0 2 1 2 0 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 65 59 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 71 118 63
CYTB (size: 1146 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.3%)
Alanine (Ala, A)
n = 26 (6.82%)
Serine (Ser, S)
n = 24 (6.3%)
Threonine (Thr, T)
n = 25 (6.56%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.94%)
Leucine (Leu, L)
n = 60 (15.75%)
Isoleucine (Ile, I)
n = 38 (9.97%)
Methionine (Met, M)
n = 17 (4.46%)
Proline (Pro, P)
n = 24 (6.3%)
Phenylalanine (Phe, F)
n = 27 (7.09%)
Tyrosine (Tyr, Y)
n = 14 (3.67%)
Tryptophan (Trp, W)
n = 12 (3.15%)
Aspartic acid (Asp, D)
n = 10 (2.62%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 19 (4.99%)
Glutamine (Gln, Q)
n = 6 (1.57%)
Histidine (His, H)
n = 12 (3.15%)
Lysine (Lys, K)
n = 10 (2.62%)
Arginine (Arg, R)
n = 8 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 15 10 16 23 0 11 6 0 1 3 11 0 5 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 13 10 0 0 6 17 1 1 5 18 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 3 7 12 0 0 2 4 10 0 0 5 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 3 7 10 0 0 3 4 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 99 112 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 97 78 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 154 171 53
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 12 (3.77%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 32 (10.06%)
Methionine (Met, M)
n = 16 (5.03%)
Proline (Pro, P)
n = 18 (5.66%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 10 (3.14%)
Asparagine (Asn, N)
n = 15 (4.72%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 20 13 4 4 33 2 12 6 0 2 3 6 1 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 16 8 0 2 6 4 1 5 3 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 4 4 14 0 0 0 4 8 1 0 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 0 2 2 8 0 0 1 7 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 78 94 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 101 151 58
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 19 (5.48%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 23 6 7 41 1 10 12 0 0 4 3 0 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 14 5 1 3 5 5 0 6 6 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 0 3 14 14 0 1 1 3 6 0 0 5 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 12 0 0 0 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 98 132 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 108 65 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 128 169 48
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 19 (5.48%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 23 6 7 41 1 10 12 0 0 4 3 0 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 14 5 1 3 5 5 0 6 6 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 0 3 14 14 0 1 1 3 6 0 0 5 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 12 0 0 0 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 98 132 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 108 65 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 128 169 48
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 51 (11.14%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 87 (19.0%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 30 (6.55%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 26 28 10 17 45 1 11 8 0 1 4 8 0 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 4 13 9 0 2 6 10 0 0 8 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 1 4 17 18 1 3 8 9 8 0 3 2 17 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 0 3 12 1 2 0 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 129 157 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 125 85 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 167 203 79
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 6 0 5 15 1 0 2 0 0 1 6 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 2 6 0 1 2 2 0 0 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 3 2 5 0 0 0 1 2 0 0 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 28 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 20 46
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 31 51 14
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.12%)
Alanine (Ala, A)
n = 39 (6.45%)
Serine (Ser, S)
n = 47 (7.77%)
Threonine (Thr, T)
n = 60 (9.92%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 12 (1.98%)
Leucine (Leu, L)
n = 86 (14.21%)
Isoleucine (Ile, I)
n = 64 (10.58%)
Methionine (Met, M)
n = 42 (6.94%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 45 (7.44%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 40 (6.61%)
Glutamine (Gln, Q)
n = 15 (2.48%)
Histidine (His, H)
n = 17 (2.81%)
Lysine (Lys, K)
n = 18 (2.98%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 38 40 10 10 55 1 10 15 0 2 0 10 0 10 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 3 21 14 1 1 14 16 0 6 4 17 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 27 0 6 8 25 0 2 6 3 13 0 0 9 31 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 2 9 17 1 3 1 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 143 232 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 165 128 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 229 272 99
ND6 (size: 504 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.98%)
Alanine (Ala, A)
n = 7 (4.19%)
Serine (Ser, S)
n = 14 (8.38%)
Threonine (Thr, T)
n = 7 (4.19%)
Cysteine (Cys, C)
n = 2 (1.2%)
Valine (Val, V)
n = 28 (16.77%)
Leucine (Leu, L)
n = 23 (13.77%)
Isoleucine (Ile, I)
n = 8 (4.79%)
Methionine (Met, M)
n = 8 (4.79%)
Proline (Pro, P)
n = 3 (1.8%)
Phenylalanine (Phe, F)
n = 15 (8.98%)
Tyrosine (Tyr, Y)
n = 8 (4.79%)
Tryptophan (Trp, W)
n = 4 (2.4%)
Aspartic acid (Asp, D)
n = 4 (2.4%)
Glutamic acid (Glu, E)
n = 10 (5.99%)
Asparagine (Asn, N)
n = 2 (1.2%)
Glutamine (Gln, Q)
n = 1 (0.6%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.6%)
Arginine (Arg, R)
n = 2 (1.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 3 1 0 0 1 12 0 1 16 1 6 5 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 6 0 1 0 14 0 2 4 1 0 2 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 2 0 7 0 8 0 2 9 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 6 4 4 0 1 0 2 0 0 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 33 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 24 27 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 3 37 96
Total protein-coding genes (size: 11408 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.6%)
Alanine (Ala, A)
n = 245 (6.45%)
Serine (Ser, S)
n = 297 (7.81%)
Threonine (Thr, T)
n = 315 (8.29%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 163 (4.29%)
Leucine (Leu, L)
n = 599 (15.76%)
Isoleucine (Ile, I)
n = 363 (9.55%)
Methionine (Met, M)
n = 222 (5.84%)
Proline (Pro, P)
n = 191 (5.02%)
Phenylalanine (Phe, F)
n = 236 (6.21%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 162 (4.26%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
156 207 195 79 77 302 13 113 92 1 36 25 89 13 88 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 14 16 41 121 81 2 37 68 96 12 31 41 117 2 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
99 153 2 40 69 142 3 22 21 63 70 4 15 52 110 43
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 84 8 32 36 89 4 11 11 43 1 2 0 6 3 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
781 927 1200 894
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
458 1005 756 1583
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
110 1182 1704 806

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.