Viewing data for Varanus salvator


Scientific name Varanus salvator
Common name Water monitor
Maximum lifespan 15.70 years (Varanus salvator@AnAge)

Total mtDNA (size: 17489 bases) GC AT G C A T
Base content (bases) 7712 9766 5434 2278 4356 5410
Base content per 1 kb (bases) 441 558 311 130 249 309
Base content (%) 44.1% 55.8%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5116 6254 3804 1312 2784 3470
Base content per 1 kb (bases) 450 550 334 115 245 305
Base content (%) 45.0% 55.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1484 bases) GC AT G C A T
Base content (bases) 636 846 394 242 364 482
Base content per 1 kb (bases) 429 570 265 163 245 325
Base content (%) 42.9% 57.0%
Total rRNA-coding genes (size: 2411 bases) GC AT G C A T
Base content (bases) 1095 1316 685 410 476 840
Base content per 1 kb (bases) 454 546 284 170 197 348
Base content (%) 45.4% 54.6%
12S rRNA gene (size: 898 bases) GC AT G C A T
Base content (bases) 416 482 258 158 174 308
Base content per 1 kb (bases) 463 537 287 176 194 343
Base content (%) 46.3% 53.7%
16S rRNA gene (size: 1513 bases) GC AT G C A T
Base content (bases) 679 834 427 252 302 532
Base content per 1 kb (bases) 449 551 282 167 200 352
Base content (%) 44.9% 55.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 326 358 254 72 162 196
Base content per 1 kb (bases) 477 523 371 105 237 287
Base content (%) 47.7% 52.3%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 77 88 66 11 39 49
Base content per 1 kb (bases) 467 533 400 67 236 297
Base content (%) 46.7% 53.3%
COX1 (size: 1596 bases) GC AT G C A T
Base content (bases) 729 867 471 258 427 440
Base content per 1 kb (bases) 457 543 295 162 268 276
Base content (%) 45.7% 54.3%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 300 387 216 84 169 218
Base content per 1 kb (bases) 435 561 313 122 245 316
Base content (%) 43.5% 56.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 358 422 246 112 202 220
Base content per 1 kb (bases) 457 538 314 143 258 281
Base content (%) 45.7% 53.8%
CYTB (size: 1133 bases) GC AT G C A T
Base content (bases) 513 620 376 137 298 322
Base content per 1 kb (bases) 453 547 332 121 263 284
Base content (%) 45.3% 54.7%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 444 521 335 109 239 282
Base content per 1 kb (bases) 460 539 347 113 247 292
Base content (%) 46.0% 53.9%
ND2 (size: 1037 bases) GC AT G C A T
Base content (bases) 468 569 374 94 237 332
Base content per 1 kb (bases) 451 549 361 91 229 320
Base content (%) 45.1% 54.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 152 194 111 41 94 100
Base content per 1 kb (bases) 439 561 321 118 272 289
Base content (%) 43.9% 56.1%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 615 758 486 129 351 407
Base content per 1 kb (bases) 448 552 354 94 255 296
Base content (%) 44.8% 55.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 134 163 108 26 73 90
Base content per 1 kb (bases) 451 549 364 88 246 303
Base content (%) 45.1% 54.9%
ND5 (size: 1794 bases) GC AT G C A T
Base content (bases) 786 1008 595 191 434 574
Base content per 1 kb (bases) 438 562 332 106 242 320
Base content (%) 43.8% 56.2%
ND6 (size: 531 bases) GC AT G C A T
Base content (bases) 219 312 169 50 63 249
Base content per 1 kb (bases) 412 588 318 94 119 469
Base content (%) 41.2% 58.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.32%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 2 (0.88%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 6 8 19 23 4 4 9 1 0 5 1 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 15 5 0 2 2 3 1 0 6 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 3 4 1 0 0 7 0 2 0 0 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 4 2 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 85 77 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 70 35 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 99 84 34
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFLIMALTWLSLTLLFLTKLLLTTLTNPPSPHLNTPSTPNWTWSWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 4 (7.41%)
Threonine (Thr, T)
n = 10 (18.52%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 13 (24.07%)
Isoleucine (Ile, I)
n = 1 (1.85%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 2 (3.7%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.26%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 1 (1.85%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 0 2 5 3 1 2 1 0 0 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 1 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 1 0 1 3 0 0 0 0 0 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 1 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 21 19 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 9 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 22 21 7
COX1 (size: 1596 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.04%)
Alanine (Ala, A)
n = 38 (7.16%)
Serine (Ser, S)
n = 35 (6.59%)
Threonine (Thr, T)
n = 35 (6.59%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 32 (6.03%)
Leucine (Leu, L)
n = 61 (11.49%)
Isoleucine (Ile, I)
n = 42 (7.91%)
Methionine (Met, M)
n = 37 (6.97%)
Proline (Pro, P)
n = 31 (5.84%)
Phenylalanine (Phe, F)
n = 39 (7.34%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 20 (3.77%)
Aspartic acid (Asp, D)
n = 13 (2.45%)
Glutamic acid (Glu, E)
n = 11 (2.07%)
Asparagine (Asn, N)
n = 19 (3.58%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 21 (3.95%)
Lysine (Lys, K)
n = 10 (1.88%)
Arginine (Arg, R)
n = 10 (1.88%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 29 29 15 19 17 2 7 7 1 9 12 9 2 17 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 2 19 15 2 8 9 25 6 6 11 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 0 4 12 14 1 1 3 5 14 3 1 4 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
19 10 1 1 12 7 3 2 2 6 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 123 148 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
85 135 101 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 213 191 97
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 11 (4.8%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 26 (11.35%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 11 (4.8%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 11 (4.8%)
Glutamic acid (Glu, E)
n = 10 (4.37%)
Asparagine (Asn, N)
n = 8 (3.49%)
Glutamine (Gln, Q)
n = 7 (3.06%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 8 9 8 10 0 2 5 2 3 3 5 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 0 5 6 0 0 3 6 0 1 5 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 0 1 6 6 0 1 1 4 6 1 0 3 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 0 6 5 4 1 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 63 71 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 63 62 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 89 85 47
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 11 (4.23%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 5 2 9 15 2 4 10 1 2 5 7 0 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 9 4 0 3 6 11 0 0 8 5 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 1 3 3 6 0 0 3 0 11 1 0 0 3 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 1 3 4 0 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 73 58 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 69 58 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 103 103 43
CYTB (size: 1133 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.91%)
Alanine (Ala, A)
n = 23 (6.12%)
Serine (Ser, S)
n = 22 (5.85%)
Threonine (Thr, T)
n = 37 (9.84%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 9 (2.39%)
Leucine (Leu, L)
n = 66 (17.55%)
Isoleucine (Ile, I)
n = 32 (8.51%)
Methionine (Met, M)
n = 12 (3.19%)
Proline (Pro, P)
n = 21 (5.59%)
Phenylalanine (Phe, F)
n = 28 (7.45%)
Tyrosine (Tyr, Y)
n = 10 (2.66%)
Tryptophan (Trp, W)
n = 12 (3.19%)
Aspartic acid (Asp, D)
n = 7 (1.86%)
Glutamic acid (Glu, E)
n = 6 (1.6%)
Asparagine (Asn, N)
n = 20 (5.32%)
Glutamine (Gln, Q)
n = 10 (2.66%)
Histidine (His, H)
n = 16 (4.26%)
Lysine (Lys, K)
n = 9 (2.39%)
Arginine (Arg, R)
n = 7 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 22 7 17 17 15 4 13 8 2 3 1 5 0 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 2 11 9 1 0 10 15 1 6 8 7 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 14 0 0 11 10 0 1 0 4 6 2 0 0 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 0 1 6 9 0 0 2 4 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 107 111 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 78 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 167 132 62
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.3%)
Alanine (Ala, A)
n = 23 (7.17%)
Serine (Ser, S)
n = 28 (8.72%)
Threonine (Thr, T)
n = 27 (8.41%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 8 (2.49%)
Leucine (Leu, L)
n = 59 (18.38%)
Isoleucine (Ile, I)
n = 35 (10.9%)
Methionine (Met, M)
n = 14 (4.36%)
Proline (Pro, P)
n = 23 (7.17%)
Phenylalanine (Phe, F)
n = 14 (4.36%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 11 (3.43%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 27 14 5 22 23 3 6 8 1 0 5 3 0 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 2 5 12 6 0 1 2 13 1 4 8 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 7 0 4 10 10 1 1 2 2 7 0 0 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 2 0 3 8 0 1 4 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 97 98 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 98 55 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 140 129 44
ND2 (size: 1037 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.65%)
Alanine (Ala, A)
n = 26 (7.56%)
Serine (Ser, S)
n = 29 (8.43%)
Threonine (Thr, T)
n = 42 (12.21%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 66 (19.19%)
Isoleucine (Ile, I)
n = 42 (12.21%)
Methionine (Met, M)
n = 17 (4.94%)
Proline (Pro, P)
n = 24 (6.98%)
Phenylalanine (Phe, F)
n = 11 (3.2%)
Tyrosine (Tyr, Y)
n = 4 (1.16%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 10 (2.91%)
Lysine (Lys, K)
n = 10 (2.91%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 32 17 9 23 24 4 6 9 0 0 2 3 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 3 17 6 0 1 1 14 0 0 12 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 18 0 2 7 15 0 1 4 2 2 1 0 5 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 0 0 2 9 1 0 2 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 108 130 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 116 53 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 150 148 41
ND3 (size: 1037 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.65%)
Alanine (Ala, A)
n = 26 (7.56%)
Serine (Ser, S)
n = 29 (8.43%)
Threonine (Thr, T)
n = 42 (12.21%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 66 (19.19%)
Isoleucine (Ile, I)
n = 42 (12.21%)
Methionine (Met, M)
n = 17 (4.94%)
Proline (Pro, P)
n = 24 (6.98%)
Phenylalanine (Phe, F)
n = 11 (3.2%)
Tyrosine (Tyr, Y)
n = 4 (1.16%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 10 (2.91%)
Lysine (Lys, K)
n = 10 (2.91%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 32 17 9 23 24 4 6 9 0 0 2 3 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 3 17 6 0 1 1 14 0 0 12 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 18 0 2 7 15 0 1 4 2 2 1 0 5 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 0 0 2 9 1 0 2 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 108 130 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 116 53 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 150 148 41
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 42 (9.19%)
Threonine (Thr, T)
n = 58 (12.69%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 97 (21.23%)
Isoleucine (Ile, I)
n = 39 (8.53%)
Methionine (Met, M)
n = 28 (6.13%)
Proline (Pro, P)
n = 29 (6.35%)
Phenylalanine (Phe, F)
n = 19 (4.16%)
Tyrosine (Tyr, Y)
n = 11 (2.41%)
Tryptophan (Trp, W)
n = 9 (1.97%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.63%)
Glutamine (Gln, Q)
n = 11 (2.41%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 16 (3.5%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 28 21 9 36 26 5 20 9 2 0 4 3 0 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 4 2 8 16 0 1 7 9 0 4 19 5 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 17 0 5 16 11 3 1 6 4 7 1 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 0 2 16 0 0 4 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 136 160 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 148 73 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 202 174 59
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 15 (15.31%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 3 (3.06%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 6 5 5 9 9 0 0 0 0 0 1 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 2 4 0 1 2 1 0 0 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 1 0 4 5 0 0 0 0 0 0 0 1 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 30 38 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 16 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 47 36 14
ND5 (size: 1794 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.52%)
Alanine (Ala, A)
n = 48 (8.04%)
Serine (Ser, S)
n = 49 (8.21%)
Threonine (Thr, T)
n = 69 (11.56%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 12 (2.01%)
Leucine (Leu, L)
n = 88 (14.74%)
Isoleucine (Ile, I)
n = 67 (11.22%)
Methionine (Met, M)
n = 33 (5.53%)
Proline (Pro, P)
n = 29 (4.86%)
Phenylalanine (Phe, F)
n = 29 (4.86%)
Tyrosine (Tyr, Y)
n = 9 (1.51%)
Tryptophan (Trp, W)
n = 14 (2.35%)
Aspartic acid (Asp, D)
n = 9 (1.51%)
Glutamic acid (Glu, E)
n = 11 (1.84%)
Asparagine (Asn, N)
n = 32 (5.36%)
Glutamine (Gln, Q)
n = 19 (3.18%)
Histidine (His, H)
n = 16 (2.68%)
Lysine (Lys, K)
n = 24 (4.02%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 40 29 18 21 34 3 11 17 2 3 4 5 0 7 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 7 24 15 2 2 11 12 2 6 11 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
44 16 0 2 18 18 3 3 5 1 8 3 1 5 27 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 1 3 6 24 0 0 1 5 2 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 148 233 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 187 121 229
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 260 220 95
ND6 (size: 531 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.2%)
Alanine (Ala, A)
n = 5 (2.84%)
Serine (Ser, S)
n = 20 (11.36%)
Threonine (Thr, T)
n = 2 (1.14%)
Cysteine (Cys, C)
n = 3 (1.7%)
Valine (Val, V)
n = 34 (19.32%)
Leucine (Leu, L)
n = 34 (19.32%)
Isoleucine (Ile, I)
n = 4 (2.27%)
Methionine (Met, M)
n = 8 (4.55%)
Proline (Pro, P)
n = 4 (2.27%)
Phenylalanine (Phe, F)
n = 12 (6.82%)
Tyrosine (Tyr, Y)
n = 11 (6.25%)
Tryptophan (Trp, W)
n = 3 (1.7%)
Aspartic acid (Asp, D)
n = 2 (1.14%)
Glutamic acid (Glu, E)
n = 3 (1.7%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 5 0 0 2 6 0 1 17 2 3 12 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 3 1 0 1 9 3 4 9 3 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 9 0 3 2 6 0 10 1 3 21 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 2 0 0 0 3 0 0 0 0 1 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 15 23 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 25 19 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 10 21 87
Total protein-coding genes (size: 11397 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 291 (7.67%)
Threonine (Thr, T)
n = 389 (10.25%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 142 (3.74%)
Leucine (Leu, L)
n = 655 (17.26%)
Isoleucine (Ile, I)
n = 332 (8.75%)
Methionine (Met, M)
n = 186 (4.9%)
Proline (Pro, P)
n = 220 (5.8%)
Phenylalanine (Phe, F)
n = 207 (5.45%)
Tyrosine (Tyr, Y)
n = 98 (2.58%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 58 (1.53%)
Glutamic acid (Glu, E)
n = 83 (2.19%)
Asparagine (Asn, N)
n = 145 (3.82%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 113 (2.98%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 67 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
110 222 148 110 198 206 33 84 85 13 37 44 47 14 78 129
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 7 20 26 125 88 6 28 57 116 22 34 92 91 3 58
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
196 131 4 35 94 104 10 15 33 33 65 16 24 32 113 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 74 9 14 44 89 7 7 20 35 5 1 1 7 0 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
751 1045 1198 794
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 1097 698 1522
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
205 1544 1394 645

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.