Viewing data for Ardea purpurea


Scientific name Ardea purpurea
Common name Purple heron
Maximum lifespan 25.40 years (Ardea purpurea@AnAge)

Total mtDNA (size: 18722 bases) GC AT G C A T
Base content (bases) 8446 10276 5768 2678 4523 5753
Base content per 1 kb (bases) 451 549 308 143 242 307
Base content (%) 45.1% 54.9%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5302 6077 3863 1439 2695 3382
Base content per 1 kb (bases) 466 534 339 126 237 297
Base content (%) 46.6% 53.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1619 bases) GC AT G C A T
Base content (bases) 689 930 415 274 399 531
Base content per 1 kb (bases) 426 574 256 169 246 328
Base content (%) 42.6% 57.4%
Total rRNA-coding genes (size: 2559 bases) GC AT G C A T
Base content (bases) 1181 1378 683 498 547 831
Base content per 1 kb (bases) 462 538 267 195 214 325
Base content (%) 46.2% 53.8%
12S rRNA gene (size: 969 bases) GC AT G C A T
Base content (bases) 463 506 262 201 200 306
Base content per 1 kb (bases) 478 522 270 207 206 316
Base content (%) 47.8% 52.2%
16S rRNA gene (size: 1590 bases) GC AT G C A T
Base content (bases) 718 872 421 297 347 525
Base content per 1 kb (bases) 452 548 265 187 218 330
Base content (%) 45.2% 54.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 321 363 255 66 154 209
Base content per 1 kb (bases) 469 531 373 96 225 306
Base content (%) 46.9% 53.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 63 12 39 54
Base content per 1 kb (bases) 446 554 375 71 232 321
Base content (%) 44.6% 55.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 723 828 465 258 396 432
Base content per 1 kb (bases) 466 534 300 166 255 279
Base content (%) 46.6% 53.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 319 365 218 101 156 209
Base content per 1 kb (bases) 466 534 319 148 228 306
Base content (%) 46.6% 53.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 375 409 252 123 192 217
Base content per 1 kb (bases) 478 522 321 157 245 277
Base content (%) 47.8% 52.2%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 559 584 416 143 270 314
Base content per 1 kb (bases) 489 511 364 125 236 275
Base content (%) 48.9% 51.1%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 462 516 327 135 262 254
Base content per 1 kb (bases) 472 528 334 138 268 260
Base content (%) 47.2% 52.8%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 442 599 337 105 264 335
Base content per 1 kb (bases) 425 575 324 101 254 322
Base content (%) 42.5% 57.5%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 163 189 119 44 97 92
Base content per 1 kb (bases) 463 537 338 125 276 261
Base content (%) 46.3% 53.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 641 737 494 147 322 415
Base content per 1 kb (bases) 465 535 358 107 234 301
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 136 161 100 36 74 87
Base content per 1 kb (bases) 458 542 337 121 249 293
Base content (%) 45.8% 54.2%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 840 975 625 215 415 560
Base content per 1 kb (bases) 463 537 344 118 229 309
Base content (%) 46.3% 53.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 251 271 195 56 58 213
Base content per 1 kb (bases) 481 519 374 107 111 408
Base content (%) 48.1% 51.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 29 (12.78%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 63 (27.75%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 14 8 2 24 28 4 5 8 0 0 3 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 8 6 0 1 4 3 0 1 5 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 2 0 4 2 0 0 4 1 2 0 0 2 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 3 0 1 2 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 91 75 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 34 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 97 100 21
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLTLLMSWTIFSLVIQPKLLAFTTANPPSTKSKMSSKTTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 1 2 3 0 1 1 1 0 1 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 1 1 0 0 0 0 0 1 3 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 1 0 3 1 2 0 0 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 20 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 24 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 27 (5.23%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 28 23 8 8 37 3 5 6 3 6 10 15 4 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 25 15 0 10 13 20 4 2 7 20 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 1 5 9 9 0 0 3 6 12 1 0 5 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 3 12 8 1 0 1 6 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 123 134 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 200 204 86
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 19 9 4 7 13 3 3 7 1 3 6 4 1 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 3 7 0 1 3 4 0 2 5 6 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 3 7 7 0 0 3 2 6 2 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 4 2 10 3 1 2 0 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 62 57 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 59 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 97 90 27
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 5 5 10 13 2 4 8 0 3 5 6 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 8 13 0 2 6 9 2 1 6 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 2 1 7 5 0 1 5 1 10 1 1 0 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 3 1 3 3 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 71 57 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 114 104 31
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 25 (6.58%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 67 (17.63%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 28 (7.37%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 23 10 8 22 32 3 2 7 1 1 6 10 0 4 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 5 15 5 0 3 9 11 2 3 13 11 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 11 0 1 10 10 0 0 1 2 11 1 0 2 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 1 5 8 2 1 4 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 121 100 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 103 77 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 192 137 39
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 21 (6.46%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 27 (8.31%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 8 7 14 27 6 8 4 1 3 3 8 0 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 13 12 0 3 3 6 1 5 13 8 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 7 2 6 12 4 1 2 3 7 7 1 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 7 4 1 3 6 1 0 4 3 1 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 96 82 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 101 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 130 117 54
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 46 (13.29%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 67 (19.36%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 15 (4.34%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 13 12 9 28 10 8 8 1 1 0 6 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 11 12 1 1 5 4 1 6 5 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 20 0 5 7 12 1 0 4 2 5 2 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 13 2 1 0 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 102 126 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 120 61 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 115 148 61
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 46 (13.29%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 67 (19.36%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 15 (4.34%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 13 12 9 28 10 8 8 1 1 0 6 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 11 12 1 1 5 4 1 6 5 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 20 0 5 7 12 1 0 4 2 5 2 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 13 2 1 0 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 102 126 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 120 61 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 115 148 61
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 56 (12.23%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 29 22 11 25 49 3 11 11 2 2 2 5 0 1 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 17 12 0 4 7 6 2 1 15 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 21 0 3 9 10 3 1 9 4 9 3 2 2 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 0 2 9 1 2 1 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 156 148 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 142 76 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 196 191 52
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 6 2 2 12 0 4 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 4 3 0 1 2 0 1 0 3 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 4 5 0 0 4 1 1 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 29 27 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 42 42 11
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.63%)
Alanine (Ala, A)
n = 50 (8.28%)
Serine (Ser, S)
n = 49 (8.11%)
Threonine (Thr, T)
n = 68 (11.26%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 108 (17.88%)
Isoleucine (Ile, I)
n = 51 (8.44%)
Methionine (Met, M)
n = 31 (5.13%)
Proline (Pro, P)
n = 32 (5.3%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 27 (4.47%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 19 (3.15%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 39 28 9 34 49 8 7 18 2 1 4 5 1 5 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 10 28 12 0 5 14 11 4 4 10 17 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 28 0 6 13 16 0 2 12 2 11 0 1 8 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 4 2 7 19 0 0 4 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 174 211 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 185 113 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 266 236 79
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 2 0 2 6 8 0 0 15 1 7 13 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 5 0 3 2 9 0 3 17 1 2 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 7 0 1 2 1 0 7 1 4 10 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 1 0 1 1 0 0 4 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 20 14 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 17 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 8 27 70
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 296 (7.8%)
Serine (Ser, S)
n = 277 (7.3%)
Threonine (Thr, T)
n = 352 (9.27%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 166 (4.37%)
Leucine (Leu, L)
n = 679 (17.88%)
Isoleucine (Ile, I)
n = 288 (7.58%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 217 (5.72%)
Tyrosine (Tyr, Y)
n = 112 (2.95%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 130 (3.42%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 86 (2.26%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
68 220 136 76 163 303 50 70 84 12 35 41 70 20 53 164
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
28 8 21 51 137 105 3 40 68 78 36 29 89 103 10 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
162 148 7 43 87 85 7 7 48 35 77 17 17 25 105 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
79 67 26 14 48 77 9 8 19 38 6 2 2 6 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
839 1097 1079 783
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1101 693 1514
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
251 1528 1464 555

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.