Viewing data for Balaenoptera acutorostrata


Scientific name Balaenoptera acutorostrata
Common name Minke whale
Maximum lifespan 50.00 years (Balaenoptera acutorostrata@AnAge)

Total mtDNA (size: 16417 bases) GC AT G C A T
Base content (bases) 6636 9781 4518 2118 4357 5424
Base content per 1 kb (bases) 404 596 275 129 265 330
Base content (%) 40.4% 59.6%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4660 6689 3372 1288 3032 3657
Base content per 1 kb (bases) 411 589 297 113 267 322
Base content (%) 41.1% 58.9%
D-loop (size: 935 bases) GC AT G C A T
Base content (bases) 350 585 215 135 292 293
Base content per 1 kb (bases) 374 626 230 144 312 313
Base content (%) 37.4% 62.6%
Total tRNA-coding genes (size: 1523 bases) GC AT G C A T
Base content (bases) 568 955 338 230 420 535
Base content per 1 kb (bases) 373 627 222 151 276 351
Base content (%) 37.3% 62.7%
Total rRNA-coding genes (size: 2558 bases) GC AT G C A T
Base content (bases) 1034 1524 579 455 602 922
Base content per 1 kb (bases) 404 596 226 178 235 360
Base content (%) 40.4% 59.6%
12S rRNA gene (size: 980 bases) GC AT G C A T
Base content (bases) 419 561 237 182 218 343
Base content per 1 kb (bases) 428 572 242 186 222 350
Base content (%) 42.8% 57.2%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 615 963 342 273 384 579
Base content per 1 kb (bases) 390 610 217 173 243 367
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 262 419 195 67 201 218
Base content per 1 kb (bases) 385 615 286 98 295 320
Base content (%) 38.5% 61.5%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 69 123 59 10 52 71
Base content per 1 kb (bases) 359 641 307 52 271 370
Base content (%) 35.9% 64.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 668 883 423 245 438 445
Base content per 1 kb (bases) 431 569 273 158 282 287
Base content (%) 43.1% 56.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 276 408 186 90 170 238
Base content per 1 kb (bases) 404 596 272 132 249 348
Base content (%) 40.4% 59.6%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 337 449 226 111 225 224
Base content per 1 kb (bases) 429 571 288 141 286 285
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 501 639 352 149 294 345
Base content per 1 kb (bases) 439 561 309 131 258 303
Base content (%) 43.9% 56.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 389 568 283 106 253 315
Base content per 1 kb (bases) 406 594 296 111 264 329
Base content (%) 40.6% 59.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 398 646 311 87 269 377
Base content per 1 kb (bases) 381 619 298 83 258 361
Base content (%) 38.1% 61.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 138 208 100 38 98 110
Base content per 1 kb (bases) 399 601 289 110 283 318
Base content (%) 39.9% 60.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 561 817 419 142 378 439
Base content per 1 kb (bases) 407 593 304 103 274 319
Base content (%) 40.7% 59.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 121 176 82 39 93 83
Base content per 1 kb (bases) 407 593 276 131 313 279
Base content (%) 40.7% 59.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 761 1060 586 175 474 586
Base content per 1 kb (bases) 418 582 322 96 260 322
Base content (%) 41.8% 58.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 161 35 105 227
Base content per 1 kb (bases) 371 629 305 66 199 430
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 27 (11.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 11 4 9 18 2 9 8 0 2 2 8 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 6 4 0 3 2 4 0 5 4 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 4 1 4 0 2 3 0 2 1 0 3 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 5 0 1 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 65 85 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 38 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 66 95 60
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMFLALFMLFQLKISNHSYFPSPKPMYTKTQKQQTPWNTTWTKIYLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.59%)
Serine (Ser, S)
n = 5 (7.94%)
Threonine (Thr, T)
n = 9 (14.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (17.46%)
Isoleucine (Ile, I)
n = 3 (4.76%)
Methionine (Met, M)
n = 4 (6.35%)
Proline (Pro, P)
n = 6 (9.52%)
Phenylalanine (Phe, F)
n = 4 (6.35%)
Tyrosine (Tyr, Y)
n = 3 (4.76%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.17%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 1 (1.59%)
Lysine (Lys, K)
n = 5 (7.94%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 2 3 2 0 3 5 0 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 1 1 1 2 0 0 1 2 1 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 19 24 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 18 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 20 29 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 38 (7.36%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.36%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 36 (6.98%)
Methionine (Met, M)
n = 32 (6.2%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 27 7 5 36 1 11 4 2 5 13 19 1 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 8 14 15 1 13 13 19 3 12 10 7 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 0 3 9 15 0 0 3 11 8 1 1 6 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 2 2 13 9 0 1 2 4 1 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 110 140 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 135 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 178 211 109
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 13 2 3 20 1 7 4 2 3 5 6 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 0 4 4 0 0 5 3 0 2 4 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 1 2 4 9 0 2 3 3 6 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 1 4 7 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 58 67 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 73 112 35
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 14 (5.36%)
Serine (Ser, S)
n = 21 (8.05%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 17 (6.51%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 10 7 5 6 15 1 6 7 0 2 4 8 1 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 5 5 3 1 3 9 8 0 1 7 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 0 4 2 11 0 0 4 4 7 0 0 4 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 0 3 3 0 1 2 3 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 68 62 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 93 106 56
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 28 13 5 11 30 2 11 5 1 3 5 9 0 6 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 8 18 0 7 10 6 1 2 8 12 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 0 5 5 8 0 2 2 4 11 2 0 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 1 1 11 9 1 0 1 7 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 98 110 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 97 76 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 157 159 54
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 27 (8.49%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.14%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 13 (4.09%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 14 (4.4%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 17 8 8 34 1 6 7 0 0 1 9 0 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 11 13 0 2 4 4 2 4 8 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 0 0 8 8 2 0 3 5 8 0 0 7 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 7 0 0 1 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 92 96 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 60 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 96 159 55
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 21 32 5 13 31 4 10 11 0 2 0 4 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 1 13 8 0 2 4 7 1 3 8 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 25 1 3 8 9 0 1 1 5 4 0 0 4 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 93 142 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 106 59 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 112 176 51
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 21 32 5 13 31 4 10 11 0 2 0 4 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 1 13 8 0 2 4 7 1 3 8 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 25 1 3 8 9 0 1 1 5 4 0 0 4 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 93 142 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 106 59 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 112 176 51
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 26 31 15 19 43 5 13 11 0 3 2 7 0 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 6 12 13 0 3 6 7 2 5 10 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 2 15 10 0 1 9 6 9 1 0 6 16 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 2 0 3 11 0 2 2 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 141 157 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 119 85 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 159 197 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 8 3 5 8 0 6 2 0 1 2 1 3 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 3 4 0 2 1 1 0 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 4 2 0 0 2 1 2 0 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 23 29 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 22 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 37 37 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 42 (6.93%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 12 (1.98%)
Leucine (Leu, L)
n = 100 (16.5%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 34 (5.61%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 37 31 13 29 45 1 11 21 0 1 4 7 0 13 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 4 24 13 0 0 9 17 1 4 17 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 27 1 9 14 9 1 5 4 7 9 0 1 7 28 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 1 10 20 2 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 162 218 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 163 131 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 261 237 98
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 15 (8.57%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 30 (17.14%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 2 0 0 1 0 8 1 0 16 1 6 7 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 0 3 0 12 0 7 8 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 4 0 1 2 7 1 7 2 4 9 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 3 0 2 2 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 6 43 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 24 27 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 5 35 91
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 253 (6.66%)
Serine (Ser, S)
n = 263 (6.92%)
Threonine (Thr, T)
n = 332 (8.74%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 176 (4.63%)
Leucine (Leu, L)
n = 621 (16.34%)
Isoleucine (Ile, I)
n = 325 (8.55%)
Methionine (Met, M)
n = 233 (6.13%)
Proline (Pro, P)
n = 206 (5.42%)
Phenylalanine (Phe, F)
n = 240 (6.32%)
Tyrosine (Tyr, Y)
n = 127 (3.34%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 94 (2.47%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
139 186 200 72 117 295 19 106 89 5 38 39 87 12 90 150
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 10 14 43 107 101 2 47 64 85 18 47 80 77 2 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
108 166 8 38 72 90 5 21 37 57 70 9 12 45 113 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 77 16 15 52 91 5 6 16 41 2 2 0 7 2 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
803 967 1204 827
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 996 743 1595
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
150 1294 1609 748

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.