Viewing data for Camelus bactrianus


Scientific name Camelus bactrianus
Common name Bactrian camel
Maximum lifespan 35.40 years (Camelus bactrianus@AnAge)

Total mtDNA (size: 16659 bases) GC AT G C A T
Base content (bases) 6984 9675 4410 2574 4523 5152
Base content per 1 kb (bases) 419 581 265 155 272 309
Base content (%) 41.9% 58.1%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4781 6560 3162 1619 3202 3358
Base content per 1 kb (bases) 422 578 279 143 282 296
Base content (%) 42.2% 57.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1505 bases) GC AT G C A T
Base content (bases) 588 917 329 259 412 505
Base content per 1 kb (bases) 391 609 219 172 274 336
Base content (%) 39.1% 60.9%
Total rRNA-coding genes (size: 2533 bases) GC AT G C A T
Base content (bases) 1016 1517 542 474 615 902
Base content per 1 kb (bases) 401 599 214 187 243 356
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 968 bases) GC AT G C A T
Base content (bases) 415 553 226 189 218 335
Base content per 1 kb (bases) 429 571 233 195 225 346
Base content (%) 42.9% 57.1%
16S rRNA gene (size: 1565 bases) GC AT G C A T
Base content (bases) 601 964 316 285 397 567
Base content per 1 kb (bases) 384 616 202 182 254 362
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 276 405 189 87 195 210
Base content per 1 kb (bases) 405 595 278 128 286 308
Base content (%) 40.5% 59.5%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 73 131 55 18 56 75
Base content per 1 kb (bases) 358 642 270 88 275 368
Base content (%) 35.8% 64.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 679 866 386 293 470 396
Base content per 1 kb (bases) 439 561 250 190 304 256
Base content (%) 43.9% 56.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 275 409 164 111 199 210
Base content per 1 kb (bases) 402 598 240 162 291 307
Base content (%) 40.2% 59.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 367 417 225 142 229 188
Base content per 1 kb (bases) 468 532 287 181 292 240
Base content (%) 46.8% 53.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 489 651 318 171 320 331
Base content per 1 kb (bases) 429 571 279 150 281 290
Base content (%) 42.9% 57.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 434 522 299 135 257 265
Base content per 1 kb (bases) 454 546 313 141 269 277
Base content (%) 45.4% 54.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 393 649 286 107 287 362
Base content per 1 kb (bases) 377 623 274 103 275 347
Base content (%) 37.7% 62.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 147 202 98 49 110 92
Base content per 1 kb (bases) 421 579 281 140 315 264
Base content (%) 42.1% 57.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 582 796 392 190 386 410
Base content per 1 kb (bases) 422 578 284 138 280 298
Base content (%) 42.2% 57.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 119 178 76 43 99 79
Base content per 1 kb (bases) 401 599 256 145 333 266
Base content (%) 40.1% 59.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 760 1061 529 231 508 553
Base content per 1 kb (bases) 417 583 290 127 279 304
Base content (%) 41.7% 58.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 209 319 160 49 108 211
Base content per 1 kb (bases) 396 604 303 93 205 400
Base content (%) 39.6% 60.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 9 3 7 19 1 8 6 1 1 2 4 4 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 10 5 0 1 1 7 2 5 2 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 1 4 1 2 1 0 4 2 1 0 2 7 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 2 2 1 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 63 84 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 63 89 53
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILSMLMTLFVLFQLKISKHMYLSAPSPKSNKTRKQKTPWETKWTKIYLPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 3 2 2 3 1 1 2 3 0 0 1 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 3 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 2 3 0 0 1 1 1 0 1 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 6 2 0 1 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 21 26 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 21 20 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 13 29 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.34%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 30 (5.84%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 12 17 5 5 24 10 11 6 1 8 11 16 4 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 1 0 13 13 11 3 5 11 25 7 10 9 5 4 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 6 8 10 9 0 0 3 10 9 2 5 6 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 5 9 7 8 1 2 4 1 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 104 135 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 134 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 148 166 138
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 5 11 5 1 11 6 7 6 0 1 9 4 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 1 3 2 1 3 2 2 1 3 4 4 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 3 4 3 5 1 2 3 8 3 0 2 4 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 8 2 8 5 0 0 1 3 2 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 55 70 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 54 81 62
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 10 (3.85%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 5 7 1 6 16 6 4 5 2 6 8 2 3 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 12 3 0 3 5 9 3 6 5 0 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 5 4 3 3 7 2 2 4 9 2 4 2 3 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 1 2 2 0 1 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 70 55 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 66 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 89 79 63
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 22 9 5 8 26 7 9 4 2 1 4 10 4 8 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 4 9 10 1 2 9 12 2 4 7 8 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 17 2 3 8 10 0 0 2 7 8 1 2 6 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 3 9 8 1 3 0 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 95 110 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 93 74 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 130 147 71
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 32 (10.09%)
Serine (Ser, S)
n = 18 (5.68%)
Threonine (Thr, T)
n = 26 (8.2%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 18 (5.68%)
Leucine (Leu, L)
n = 51 (16.09%)
Isoleucine (Ile, I)
n = 23 (7.26%)
Methionine (Met, M)
n = 21 (6.62%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 16 7 10 24 4 5 4 2 4 5 5 4 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 15 11 0 1 8 3 1 5 11 4 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 4 7 5 1 0 1 5 6 0 1 8 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 3 2 1 6 1 0 0 7 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 86 91 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 97 56 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 116 117 59
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 35 4 10 29 5 9 10 0 3 3 3 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 2 7 7 0 1 7 10 0 1 10 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 3 6 8 11 0 0 2 5 6 0 0 6 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 3 1 0 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 84 144 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 96 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 106 159 60
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 35 4 10 29 5 9 10 0 3 3 3 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 2 7 7 0 1 7 10 0 1 10 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 3 6 8 11 0 0 2 5 6 0 0 6 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 3 1 0 11 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 84 144 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 96 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 106 159 60
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 35 (7.64%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 19 (4.15%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 27 12 18 35 12 13 7 4 6 3 8 1 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 2 4 11 11 6 0 9 6 2 5 13 2 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 5 7 12 9 1 2 10 10 9 3 2 6 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 3 2 2 9 3 0 2 7 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 129 156 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 119 87 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 144 167 93
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 5 3 10 2 2 2 0 1 1 3 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 0 4 5 0 1 3 0 0 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 2 6 0 0 0 1 4 0 0 0 5 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 26 28 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 18 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 28 33 27
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.29%)
Alanine (Ala, A)
n = 49 (8.09%)
Serine (Ser, S)
n = 43 (7.1%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 24 (3.96%)
Leucine (Leu, L)
n = 94 (15.51%)
Isoleucine (Ile, I)
n = 51 (8.42%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 21 31 18 18 29 8 18 15 4 5 5 13 1 20 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 4 7 26 14 2 2 9 13 2 6 16 6 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 26 2 5 13 11 3 0 11 4 13 3 3 6 28 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 4 4 6 18 5 1 3 3 2 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 142 211 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 162 128 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 225 214 121
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 15 (8.57%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 16 (9.14%)
Tyrosine (Tyr, Y)
n = 8 (4.57%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 4 1 0 1 3 4 0 1 9 0 5 10 13 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 5 0 2 0 7 0 6 12 2 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 5 7 1 0 0 5 0 6 2 0 6 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 2 1 0 0 0 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 10 48 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 27 30 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 12 30 80
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.79%)
Alanine (Ala, A)
n = 263 (6.92%)
Serine (Ser, S)
n = 266 (7.0%)
Threonine (Thr, T)
n = 315 (8.29%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 206 (5.42%)
Leucine (Leu, L)
n = 593 (15.61%)
Isoleucine (Ile, I)
n = 313 (8.24%)
Methionine (Met, M)
n = 256 (6.74%)
Proline (Pro, P)
n = 196 (5.16%)
Phenylalanine (Phe, F)
n = 236 (6.21%)
Tyrosine (Tyr, Y)
n = 137 (3.61%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 152 (4.0%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
181 132 180 73 94 233 68 97 70 20 45 51 75 35 109 127
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
76 11 14 46 117 87 13 26 67 94 33 53 83 42 18 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 128 35 54 77 72 9 11 43 74 63 13 28 62 90 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 59 37 30 38 78 18 9 12 39 8 1 0 6 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
853 915 1187 846
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
472 986 739 1604
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
412 1165 1352 872

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.