Viewing data for Loxia curvirostra


Scientific name Loxia curvirostra
Common name Red crossbill
Maximum lifespan 16.10 years (Loxia curvirostra@AnAge)

Total mtDNA (size: 16805 bases) GC AT G C A T
Base content (bases) 7667 9136 5271 2396 3991 5145
Base content per 1 kb (bases) 456 544 314 143 237 306
Base content (%) 45.6% 54.4%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5307 6069 3856 1451 2677 3392
Base content per 1 kb (bases) 466 533 339 128 235 298
Base content (%) 46.6% 53.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 631 910 371 260 394 516
Base content per 1 kb (bases) 409 591 241 169 256 335
Base content (%) 40.9% 59.1%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1172 1399 651 521 550 849
Base content per 1 kb (bases) 456 544 253 203 214 330
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 473 501 266 207 206 295
Base content per 1 kb (bases) 486 514 273 213 211 303
Base content (%) 48.6% 51.4%
16S rRNA gene (size: 1597 bases) GC AT G C A T
Base content (bases) 699 898 385 314 344 554
Base content per 1 kb (bases) 438 562 241 197 215 347
Base content (%) 43.8% 56.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 307 377 241 66 166 211
Base content per 1 kb (bases) 449 551 352 96 243 308
Base content (%) 44.9% 55.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 59 13 45 51
Base content per 1 kb (bases) 429 571 351 77 268 304
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 734 816 478 256 384 432
Base content per 1 kb (bases) 473 526 308 165 248 279
Base content (%) 47.3% 52.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 320 364 220 100 151 213
Base content per 1 kb (bases) 468 532 322 146 221 311
Base content (%) 46.8% 53.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 378 405 256 122 190 215
Base content per 1 kb (bases) 482 517 327 156 242 274
Base content (%) 48.2% 51.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 542 601 393 149 269 332
Base content per 1 kb (bases) 474 526 344 130 235 290
Base content (%) 47.4% 52.6%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 446 532 303 143 265 267
Base content per 1 kb (bases) 456 544 310 146 271 273
Base content (%) 45.6% 54.4%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 467 573 361 106 256 317
Base content per 1 kb (bases) 449 551 347 102 246 305
Base content (%) 44.9% 55.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 167 184 120 47 90 94
Base content per 1 kb (bases) 476 524 342 134 256 268
Base content (%) 47.6% 52.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 631 747 486 145 319 428
Base content per 1 kb (bases) 458 542 353 105 231 311
Base content (%) 45.8% 54.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 150 147 110 40 72 75
Base content per 1 kb (bases) 505 495 370 135 242 253
Base content (%) 50.5% 49.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 837 981 623 214 420 561
Base content per 1 kb (bases) 460 540 343 118 231 309
Base content (%) 46.0% 54.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 261 258 209 52 54 204
Base content per 1 kb (bases) 503 497 403 100 104 393
Base content (%) 50.3% 49.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 8 3 13 33 4 9 8 0 1 1 6 0 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 10 3 0 1 4 2 1 3 3 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 0 7 4 0 0 4 0 3 1 0 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 4 0 0 2 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 84 68 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 35 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 93 108 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWVTFSLIIQPKILTFVSMNPPSNKPPTAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 3 (5.45%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 1 1 0 2 0 0 2 0 1 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 4 3 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 0 2 2 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 24 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 19 21 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 19 11 9 37 5 1 7 2 5 13 20 2 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 22 19 0 6 11 24 5 4 10 16 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 14 3 2 11 11 0 0 4 6 11 0 0 1 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 10 0 4 11 9 0 2 1 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 128 129 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 213 209 73
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 11 11 4 7 17 0 1 5 1 4 3 10 1 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 9 5 0 2 1 5 0 2 4 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 3 8 6 0 0 6 0 7 0 0 0 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 12 0 0 13 4 0 3 0 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 61 57 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 60 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 99 98 26
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 5 1 5 22 1 4 7 1 4 5 8 0 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 2 14 6 2 2 7 10 0 1 5 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 1 4 5 3 0 0 5 0 11 0 0 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 1 3 4 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 71 54 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 114 106 32
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 25 (6.58%)
Leucine (Leu, L)
n = 61 (16.05%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 6 3 14 36 3 5 8 0 3 9 13 0 1 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 17 7 0 1 11 10 2 2 9 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 1 8 10 2 0 1 2 10 0 0 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 0 0 8 10 0 3 2 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 109 99 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 100 79 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 184 154 34
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 24 (7.38%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 25 (7.69%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 7 9 10 28 9 8 4 2 0 4 8 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 9 16 2 2 5 5 2 3 10 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 2 10 6 1 0 5 4 12 0 2 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 7 4 0 4 7 0 3 0 4 1 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 96 82 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 114 125 57
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 13 5 20 31 5 5 8 2 2 5 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 6 12 0 0 7 6 0 2 11 7 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 12 2 5 11 12 0 2 3 0 7 0 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 10 4 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 105 123 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 140 135 53
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 13 5 20 31 5 5 8 2 2 5 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 6 12 0 0 7 6 0 2 11 7 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 12 2 5 11 12 0 2 3 0 7 0 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 10 4 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 105 123 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 140 135 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 40 (8.73%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 36 25 10 30 50 2 5 13 1 1 4 4 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 22 14 0 4 4 6 3 5 8 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 1 5 9 12 1 0 9 3 10 0 0 2 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 3 0 2 9 1 0 1 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 159 150 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 135 80 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 192 198 54
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 4 2 3 10 2 3 3 0 0 0 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 3 2 0 1 2 1 0 0 2 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 1 1 5 3 1 0 4 0 3 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 31 24 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 50 33 8
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 52 (8.6%)
Serine (Ser, S)
n = 52 (8.6%)
Threonine (Thr, T)
n = 61 (10.08%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 103 (17.02%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 36 (5.95%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 40 28 7 24 64 5 3 14 2 4 4 6 3 7 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 6 31 14 1 3 9 19 2 6 17 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 23 1 4 18 18 1 0 11 3 8 1 0 4 22 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 0 1 9 20 1 0 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
124 168 205 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 185 109 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 270 247 70
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.44%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 34 (19.77%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 7 (4.07%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 5 0 0 3 9 0 0 14 1 1 18 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 0 2 5 9 3 2 16 1 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 0 4 4 0 6 1 2 17 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 0 0 0 0 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 16 16 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 18 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
81 8 20 64
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 307 (8.09%)
Serine (Ser, S)
n = 291 (7.67%)
Threonine (Thr, T)
n = 309 (8.14%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 198 (5.22%)
Leucine (Leu, L)
n = 668 (17.6%)
Isoleucine (Ile, I)
n = 301 (7.93%)
Methionine (Met, M)
n = 162 (4.27%)
Proline (Pro, P)
n = 224 (5.9%)
Phenylalanine (Phe, F)
n = 215 (5.66%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 133 (3.5%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
85 216 133 63 143 345 42 55 82 11 39 49 83 27 46 169
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 5 23 46 148 102 11 31 66 93 31 33 86 100 4 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 113 11 34 97 90 10 6 54 24 85 5 20 19 114 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
90 78 16 8 58 79 7 13 10 41 7 2 1 6 1 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
886 1084 1054 771
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
489 1070 692 1544
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
233 1546 1503 513

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.