Viewing data for Beryx splendens


Scientific name Beryx splendens
Common name Alfonsino
Maximum lifespan 23.00 years (Beryx splendens@AnAge)

Total mtDNA (size: 16529 bases) GC AT G C A T
Base content (bases) 7818 8711 5085 2733 4035 4676
Base content per 1 kb (bases) 473 527 308 165 244 283
Base content (%) 47.3% 52.7%
Total protein-coding genes (size: 11406 bases) GC AT G C A T
Base content (bases) 5504 5902 3777 1727 2838 3064
Base content per 1 kb (bases) 483 517 331 151 249 269
Base content (%) 48.3% 51.7%
D-loop (size: 865 bases) GC AT G C A T
Base content (bases) 336 529 202 134 261 268
Base content per 1 kb (bases) 388 612 234 155 302 310
Base content (%) 38.8% 61.2%
Total tRNA-coding genes (size: 1554 bases) GC AT G C A T
Base content (bases) 700 854 391 309 383 471
Base content per 1 kb (bases) 450 550 252 199 246 303
Base content (%) 45.0% 55.0%
Total rRNA-coding genes (size: 2643 bases) GC AT G C A T
Base content (bases) 1244 1399 694 550 542 857
Base content per 1 kb (bases) 471 529 263 208 205 324
Base content (%) 47.1% 52.9%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 470 479 260 210 194 285
Base content per 1 kb (bases) 495 505 274 221 204 300
Base content (%) 49.5% 50.5%
16S rRNA gene (size: 1694 bases) GC AT G C A T
Base content (bases) 774 920 434 340 348 572
Base content per 1 kb (bases) 457 543 256 201 205 338
Base content (%) 45.7% 54.3%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 329 354 234 95 180 174
Base content per 1 kb (bases) 482 518 343 139 264 255
Base content (%) 48.2% 51.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 83 85 67 16 33 52
Base content per 1 kb (bases) 494 506 399 95 196 310
Base content (%) 49.4% 50.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 746 805 452 294 418 387
Base content per 1 kb (bases) 481 519 291 190 270 250
Base content (%) 48.1% 51.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 307 384 195 112 186 198
Base content per 1 kb (bases) 444 556 282 162 269 287
Base content (%) 44.4% 55.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 372 413 242 130 211 202
Base content per 1 kb (bases) 474 526 308 166 269 257
Base content (%) 47.4% 52.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 545 596 378 167 297 299
Base content per 1 kb (bases) 478 522 331 146 260 262
Base content (%) 47.8% 52.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 486 489 335 151 244 245
Base content per 1 kb (bases) 498 502 344 155 250 251
Base content (%) 49.8% 50.2%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 537 509 391 146 236 273
Base content per 1 kb (bases) 513 487 374 140 226 261
Base content (%) 51.3% 48.7%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 178 171 125 53 100 71
Base content per 1 kb (bases) 510 490 358 152 287 203
Base content (%) 51.0% 49.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 659 722 460 199 345 377
Base content per 1 kb (bases) 477 523 333 144 250 273
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 153 144 106 47 78 66
Base content per 1 kb (bases) 515 485 357 158 263 222
Base content (%) 51.5% 48.5%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 874 965 626 248 439 526
Base content per 1 kb (bases) 475 525 340 135 239 286
Base content (%) 47.5% 52.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 242 280 171 71 77 203
Base content per 1 kb (bases) 464 536 328 136 148 389
Base content (%) 46.4% 53.6%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 57 (25.22%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 3 12 18 13 5 8 9 0 4 4 3 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 3 14 2 1 0 4 7 1 5 4 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 1 1 0 0 0 7 2 3 0 1 1 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 1 1 0 0 0 6 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 83 65 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 60 32 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 91 76 43
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILIFSWLIFLTFLPPKVLAHTFPNELTTQSTESPNTQAWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 1 (1.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 0 1 2 4 0 0 3 0 0 1 0 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 4 0 0 0 0 0 0 0 6 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 0 1 1 0 0 2 0 0 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 1 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 19 17 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 20 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 28 23 3
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 50 (9.69%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.1%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 9 14 15 24 5 4 5 2 6 12 20 5 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 0 1 1 29 16 4 7 10 15 13 6 12 9 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 1 7 5 11 0 0 4 4 14 0 2 5 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 4 2 14 8 0 0 2 4 2 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
165 120 124 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 137 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 195 169 99
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 8 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 6 8 10 4 9 0 5 9 0 4 6 5 3 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 8 7 2 2 4 3 0 3 7 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 4 6 0 0 3 2 6 0 0 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 2 3 11 3 1 2 1 2 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 62 52 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 63 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 80 83 54
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 10 5 9 5 12 2 3 8 0 3 6 7 0 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 11 6 1 3 8 9 2 2 8 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 2 2 6 2 0 1 2 4 8 0 0 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 2 3 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 70 53 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 106 93 51
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 33 (8.71%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 27 (7.12%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 10 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 19 7 9 15 28 3 5 5 0 6 10 11 0 9 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 3 17 12 1 1 8 14 2 5 9 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 5 0 4 12 7 0 0 1 1 13 2 0 2 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 2 3 7 9 0 0 0 10 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 102 93 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 102 74 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 174 132 59
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 21 (6.48%)
Leucine (Leu, L)
n = 63 (19.44%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 15 6 8 16 28 4 6 6 1 5 10 6 0 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 20 10 1 1 7 7 3 4 14 4 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 1 3 7 6 1 1 2 3 8 1 1 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 2 2 5 2 0 0 6 2 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 99 76 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 96 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 140 112 47
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 74 (21.33%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 17 (4.9%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 12 15 15 24 13 6 14 1 1 3 1 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 11 24 4 1 0 6 6 6 2 16 3 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 14 1 2 8 5 1 1 3 1 6 5 1 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 2 7 1 0 2 2 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 118 107 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 123 57 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 150 108 51
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 74 (21.33%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 17 (4.9%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 12 15 15 24 13 6 14 1 1 3 1 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 11 24 4 1 0 6 6 6 2 16 3 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 14 1 2 8 5 1 1 3 1 6 5 1 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 2 7 1 0 2 2 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 118 107 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 123 57 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 150 108 51
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 35 (7.63%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 45 (9.8%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 15 (3.27%)
Leucine (Leu, L)
n = 95 (20.7%)
Isoleucine (Ile, I)
n = 35 (7.63%)
Methionine (Met, M)
n = 28 (6.1%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 13 (2.83%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 15 19 9 30 40 7 8 11 2 5 5 5 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 7 16 11 1 3 17 5 4 2 17 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 12 1 2 11 7 0 0 7 4 9 2 1 2 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 2 0 6 9 1 1 2 5 3 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 148 136 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 127 75 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 185 166 76
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 5 7 10 1 1 3 0 2 0 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 0 8 6 0 0 3 2 1 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 3 1 5 0 0 2 1 1 1 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 1 1 1 0 0 0 1 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
27 35 15 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 15 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 40 36 18
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 54 (8.82%)
Serine (Ser, S)
n = 41 (6.7%)
Threonine (Thr, T)
n = 63 (10.29%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 25 (4.08%)
Leucine (Leu, L)
n = 100 (16.34%)
Isoleucine (Ile, I)
n = 49 (8.01%)
Methionine (Met, M)
n = 30 (4.9%)
Proline (Pro, P)
n = 32 (5.23%)
Phenylalanine (Phe, F)
n = 37 (6.05%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 13 (2.12%)
Asparagine (Asn, N)
n = 33 (5.39%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 8 (1.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 31 18 16 29 39 7 7 17 3 4 8 11 2 12 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 6 8 33 11 2 5 11 10 4 4 19 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 20 1 5 12 9 1 2 12 2 7 3 2 7 26 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 3 2 10 20 0 1 5 1 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 167 209 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 176 124 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 283 193 95
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 15 (8.67%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 1 6 0 1 2 13 0 0 11 1 6 6 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 7 1 2 5 3 1 6 15 3 1 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 9 1 0 1 4 0 5 4 2 8 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 4 1 1 1 0 1 1 0 3 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 21 22 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 36 20 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 14 35 68
Total protein-coding genes (size: 11428 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 245 (6.44%)
Alanine (Ala, A)
n = 348 (9.15%)
Serine (Ser, S)
n = 233 (6.12%)
Threonine (Thr, T)
n = 309 (8.12%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 215 (5.65%)
Leucine (Leu, L)
n = 661 (17.37%)
Isoleucine (Ile, I)
n = 267 (7.02%)
Methionine (Met, M)
n = 164 (4.31%)
Proline (Pro, P)
n = 222 (5.83%)
Phenylalanine (Phe, F)
n = 224 (5.89%)
Tyrosine (Tyr, Y)
n = 112 (2.94%)
Tryptophan (Trp, W)
n = 119 (3.13%)
Aspartic acid (Asp, D)
n = 78 (2.05%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 123 (3.23%)
Glutamine (Gln, Q)
n = 102 (2.68%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 72 (1.89%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
120 147 92 120 169 239 51 66 91 11 51 71 76 17 86 138
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
72 5 20 49 191 89 19 25 81 88 51 41 116 51 14 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
147 112 10 41 74 60 4 9 45 31 81 16 16 24 99 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 75 24 17 61 66 6 6 14 44 12 0 1 5 0 103
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
985 1085 990 746
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
520 1058 697 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
324 1539 1257 686

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.