Viewing data for Bison bison


Scientific name Bison bison
Common name American bison
Maximum lifespan 33.50 years (Bison bison@AnAge)

Total mtDNA (size: 16319 bases) GC AT G C A T
Base content (bases) 6390 9929 4236 2154 4431 5498
Base content per 1 kb (bases) 392 608 260 132 272 337
Base content (%) 39.2% 60.8%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4480 6856 3125 1355 3145 3711
Base content per 1 kb (bases) 395 605 276 120 277 327
Base content (%) 39.5% 60.5%
D-loop (size: 888 bases) GC AT G C A T
Base content (bases) 349 539 226 123 257 282
Base content per 1 kb (bases) 393 607 255 139 289 318
Base content (%) 39.3% 60.7%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 553 958 327 226 427 531
Base content per 1 kb (bases) 366 634 216 150 283 351
Base content (%) 36.6% 63.4%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 980 1546 541 439 593 953
Base content per 1 kb (bases) 388 612 214 174 235 377
Base content (%) 38.8% 61.2%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 388 568 217 171 216 352
Base content per 1 kb (bases) 406 594 227 179 226 368
Base content (%) 40.6% 59.4%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 592 978 324 268 377 601
Base content per 1 kb (bases) 377 623 206 171 240 383
Base content (%) 37.7% 62.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 185 76 192 228
Base content per 1 kb (bases) 383 617 272 112 282 335
Base content (%) 38.3% 61.7%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 59 142 47 12 59 83
Base content per 1 kb (bases) 294 706 234 60 294 413
Base content (%) 29.4% 70.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 652 893 398 254 452 441
Base content per 1 kb (bases) 422 578 258 164 293 285
Base content (%) 42.2% 57.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 259 425 157 102 193 232
Base content per 1 kb (bases) 379 621 230 149 282 339
Base content (%) 37.9% 62.1%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 345 436 231 114 227 209
Base content per 1 kb (bases) 442 558 296 146 291 268
Base content (%) 44.2% 55.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 474 666 331 143 297 369
Base content per 1 kb (bases) 416 584 290 125 261 324
Base content (%) 41.6% 58.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 398 558 280 118 252 306
Base content per 1 kb (bases) 416 584 293 123 264 320
Base content (%) 41.6% 58.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 363 679 278 85 291 388
Base content per 1 kb (bases) 348 652 267 82 279 372
Base content (%) 34.8% 65.2%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 142 205 100 42 97 108
Base content per 1 kb (bases) 409 591 288 121 280 311
Base content (%) 40.9% 59.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 531 847 381 150 399 448
Base content per 1 kb (bases) 385 615 276 109 290 325
Base content (%) 38.5% 61.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 105 192 71 34 96 96
Base content per 1 kb (bases) 354 646 239 114 323 323
Base content (%) 35.4% 64.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 716 1105 527 189 500 605
Base content per 1 kb (bases) 393 607 289 104 275 332
Base content (%) 39.3% 60.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 193 335 151 42 114 221
Base content per 1 kb (bases) 366 634 286 80 216 419
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 10 7 4 18 3 12 9 0 1 2 8 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 8 4 0 1 2 7 1 1 6 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 17 0 2 0 6 0 1 5 1 1 0 0 3 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 64 81 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 59 110 49
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIIFQLKISKHNFHYNPELTSTKMLKQNTPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 9 (13.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 13 (19.7%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 2 1 2 1 5 3 0 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 2 0 0 4 0 0 0 1 1 0 2 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 16 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 13 36 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 15 22 6 10 24 3 15 5 1 10 11 16 2 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 11 11 17 1 8 8 29 2 9 10 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 1 9 6 12 0 0 3 7 12 2 1 6 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 6 10 8 1 0 2 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 102 139 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 163 206 119
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 13 6 0 10 7 10 5 1 2 4 5 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 1 4 1 1 3 3 1 2 3 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 2 4 2 8 1 1 4 5 6 0 1 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 2 8 2 4 2 2 0 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 55 67 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 48 104 54
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 17 (6.56%)
Serine (Ser, S)
n = 18 (6.95%)
Threonine (Thr, T)
n = 23 (8.88%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.41%)
Leucine (Leu, L)
n = 31 (11.97%)
Isoleucine (Ile, I)
n = 16 (6.18%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 7 (2.7%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 17 (6.56%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 8 2 7 13 2 6 7 0 4 6 4 0 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 11 2 0 0 11 9 0 1 6 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 0 4 6 4 0 1 3 5 6 1 1 2 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 1 3 2 0 1 1 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 65 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 100 91 61
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 16 7 12 30 2 8 6 0 1 4 10 1 7 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 3 9 14 0 1 7 15 2 1 6 15 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 4 7 9 0 0 2 5 11 0 0 6 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 3 8 10 0 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 99 113 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 136 178 59
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.42%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 18 (5.68%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 10 (3.15%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 20 20 4 11 30 2 8 7 0 0 4 7 2 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 11 16 0 1 7 5 1 4 8 9 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 14 1 1 7 12 1 1 1 6 4 1 1 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 2 2 1 7 0 0 1 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 89 91 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 90 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 101 159 44
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 38 5 6 29 0 12 8 1 1 4 7 0 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 7 5 0 0 5 8 1 2 7 10 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 0 5 5 14 0 1 1 5 3 0 1 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 78 149 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 58 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 97 181 62
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 38 5 6 29 0 12 8 1 1 4 7 0 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 7 5 0 0 5 8 1 2 7 10 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 0 5 5 14 0 1 1 5 3 0 1 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 78 149 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 58 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 97 181 62
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 34 (7.42%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 20 34 10 15 52 4 10 10 1 2 2 9 2 12 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 6 7 13 1 3 6 9 1 6 6 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 12 3 6 11 10 1 3 7 7 9 3 0 8 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 0 4 11 0 2 0 8 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 134 160 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 109 85 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 138 203 96
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 12 2 3 13 0 3 2 0 2 0 6 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 2 5 0 2 0 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 3 4 2 0 0 1 1 2 0 0 4 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 25 27 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 23 52 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 51 (8.42%)
Threonine (Thr, T)
n = 55 (9.08%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 59 (9.74%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 22 (3.63%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 31 37 8 19 48 2 9 16 1 5 5 8 1 17 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 5 17 18 1 5 10 13 0 2 13 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 26 3 11 12 16 0 2 10 10 12 0 2 9 25 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 2 2 10 24 0 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 138 223 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 160 132 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 229 250 114
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 4 1 0 1 1 10 0 1 9 0 6 6 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 1 2 0 9 1 4 12 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 5 1 1 1 4 0 7 3 3 5 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 0 4 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 8 47 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 8 34 86
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 248 (6.53%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 311 (8.19%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 186 (4.9%)
Leucine (Leu, L)
n = 593 (15.62%)
Isoleucine (Ile, I)
n = 328 (8.64%)
Methionine (Met, M)
n = 264 (6.95%)
Proline (Pro, P)
n = 191 (5.03%)
Phenylalanine (Phe, F)
n = 244 (6.43%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 163 (4.29%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 99 (2.61%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
172 156 222 64 93 281 30 111 81 6 37 43 89 17 110 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 5 17 51 91 102 4 31 60 107 21 33 70 85 3 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 163 14 55 62 100 4 15 38 61 72 10 14 55 108 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 79 16 27 42 91 8 7 11 43 2 1 0 7 0 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 906 1219 856
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 971 750 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
191 1151 1656 800

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.