Viewing data for Arctocephalus pusillus


Scientific name Arctocephalus pusillus
Common name South African fur seal
Maximum lifespan 32.10 years (Arctocephalus pusillus@AnAge)

Total mtDNA (size: 16652 bases) GC AT G C A T
Base content (bases) 6796 9856 4478 2318 4291 5565
Base content per 1 kb (bases) 408 592 269 139 258 334
Base content (%) 40.8% 59.2%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4684 6666 3224 1460 3009 3657
Base content per 1 kb (bases) 413 587 284 129 265 322
Base content (%) 41.3% 58.7%
D-loop (size: 1193 bases) GC AT G C A T
Base content (bases) 484 709 323 161 307 402
Base content per 1 kb (bases) 406 594 271 135 257 337
Base content (%) 40.6% 59.4%
Total tRNA-coding genes (size: 1520 bases) GC AT G C A T
Base content (bases) 594 926 347 247 396 530
Base content per 1 kb (bases) 391 609 228 163 261 349
Base content (%) 39.1% 60.9%
Total rRNA-coding genes (size: 2538 bases) GC AT G C A T
Base content (bases) 1011 1527 571 440 569 958
Base content per 1 kb (bases) 398 602 225 173 224 377
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 961 bases) GC AT G C A T
Base content (bases) 396 565 231 165 211 354
Base content per 1 kb (bases) 412 588 240 172 220 368
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 615 962 340 275 358 604
Base content per 1 kb (bases) 390 610 216 174 227 383
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 283 398 205 78 189 209
Base content per 1 kb (bases) 416 584 301 115 278 307
Base content (%) 41.6% 58.4%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 55 16 52 81
Base content per 1 kb (bases) 348 652 270 78 255 397
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 668 877 396 272 451 426
Base content per 1 kb (bases) 432 568 256 176 292 276
Base content (%) 43.2% 56.8%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 263 422 171 92 188 234
Base content per 1 kb (bases) 384 616 250 134 274 342
Base content (%) 38.4% 61.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 231 122 217 214
Base content per 1 kb (bases) 450 550 295 156 277 273
Base content (%) 45.0% 55.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 492 648 339 153 295 353
Base content per 1 kb (bases) 432 568 297 134 259 310
Base content (%) 43.2% 56.8%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 419 538 292 127 246 292
Base content per 1 kb (bases) 438 562 305 133 257 305
Base content (%) 43.8% 56.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 383 661 284 99 271 390
Base content per 1 kb (bases) 367 633 272 95 260 374
Base content (%) 36.7% 63.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 140 208 100 40 95 113
Base content per 1 kb (bases) 402 598 287 115 273 325
Base content (%) 40.2% 59.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 561 817 399 162 369 448
Base content per 1 kb (bases) 407 593 290 118 268 325
Base content (%) 40.7% 59.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 122 175 78 44 93 82
Base content per 1 kb (bases) 411 589 263 148 313 276
Base content (%) 41.1% 58.9%
ND5 (size: 1827 bases) GC AT G C A T
Base content (bases) 746 1081 537 209 469 612
Base content per 1 kb (bases) 408 592 294 114 257 335
Base content (%) 40.8% 59.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 206 322 155 51 94 228
Base content per 1 kb (bases) 390 610 294 97 178 432
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 13 2 7 18 2 9 7 2 2 0 5 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 9 4 0 3 2 5 1 2 7 3 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 2 4 4 3 1 1 3 0 2 1 3 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 0 1 0 4 0 0 2 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 64 83 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 66 38 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 75 88 48
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTTIASMILTLFIVFQLKISKHHFPMSPELKSLSASKTNTPWEKKWTKIYSPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 2 0 4 0 2 3 0 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 2 0 0 0 0 0 1 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 2 4 2 0 1 1 0 1 1 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 7 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 25 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 24 18 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 14 38 10
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 43 (8.37%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 23 8 4 30 2 11 6 0 5 8 19 5 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 9 12 14 5 7 13 25 2 7 13 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 6 7 10 7 4 2 2 4 14 0 5 10 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 3 5 10 7 2 0 1 7 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 104 137 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 134 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 158 195 117
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 6 15 6 0 15 1 7 7 1 1 2 7 2 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 4 2 0 3 1 4 0 6 2 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 2 3 6 7 0 1 3 4 6 1 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 4 6 4 1 1 0 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 56 71 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 57 103 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 8 9 7 3 17 2 5 7 0 2 5 7 2 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 9 4 0 2 6 9 3 4 5 2 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 0 2 4 7 3 0 4 7 5 1 0 1 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 0 3 2 1 1 0 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 69 59 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 96 99 49
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 23 (6.07%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 12 5 14 28 6 6 5 1 3 5 9 2 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 13 11 0 1 5 18 1 2 6 12 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 2 5 16 0 0 2 5 10 0 0 4 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 3 8 9 0 0 0 7 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 101 110 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 142 167 56
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 30 (9.43%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 26 (8.18%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.77%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 28 (8.81%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 18 (5.66%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 15 2 10 31 8 6 5 1 2 0 8 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 14 10 1 0 3 8 1 3 10 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 1 3 3 10 1 0 3 3 9 0 0 6 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 4 0 3 7 0 1 1 4 2 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 91 96 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 106 140 47
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 33 5 9 31 7 5 9 0 1 3 5 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 5 9 0 1 2 12 1 4 7 9 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 1 4 6 14 2 1 1 4 5 0 0 6 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 13 1 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 89 145 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 90 184 57
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 33 5 9 31 7 5 9 0 1 3 5 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 5 9 0 1 2 12 1 4 7 9 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 1 4 6 14 2 1 1 4 5 0 0 6 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 13 1 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 89 145 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 90 184 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 34 14 10 44 11 16 10 1 1 1 11 2 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 4 14 8 5 1 5 10 1 4 13 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 4 4 7 10 2 3 9 7 9 0 2 9 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 1 0 3 13 0 0 4 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 134 163 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 118 83 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 147 202 75
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 9 2 4 9 3 1 2 0 0 0 7 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 3 1 1 1 0 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 4 3 0 2 0 2 2 2 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 24 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 21 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 33 36 17
ND5 (size: 1827 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.77%)
Alanine (Ala, A)
n = 41 (6.74%)
Serine (Ser, S)
n = 49 (8.06%)
Threonine (Thr, T)
n = 56 (9.21%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 16 (2.63%)
Leucine (Leu, L)
n = 93 (15.3%)
Isoleucine (Ile, I)
n = 56 (9.21%)
Methionine (Met, M)
n = 48 (7.89%)
Proline (Pro, P)
n = 26 (4.28%)
Phenylalanine (Phe, F)
n = 42 (6.91%)
Tyrosine (Tyr, Y)
n = 17 (2.8%)
Tryptophan (Trp, W)
n = 12 (1.97%)
Aspartic acid (Asp, D)
n = 11 (1.81%)
Glutamic acid (Glu, E)
n = 12 (1.97%)
Asparagine (Asn, N)
n = 32 (5.26%)
Glutamine (Gln, Q)
n = 17 (2.8%)
Histidine (His, H)
n = 15 (2.47%)
Lysine (Lys, K)
n = 22 (3.62%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 35 42 6 18 54 4 8 13 4 1 4 9 2 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 4 21 12 4 1 10 16 2 4 8 13 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 24 3 4 12 20 3 2 8 4 13 2 3 8 24 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 1 8 3 22 0 2 2 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 150 224 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 162 127 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 225 261 88
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 10 (5.71%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 12 (6.86%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 6 (3.43%)
Glutamic acid (Glu, E)
n = 7 (4.0%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 2 3 2 2 1 2 5 0 1 12 2 5 6 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 6 1 0 3 14 0 5 6 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 6 1 1 0 4 1 9 0 3 9 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 6 6 0 1 2 1 0 0 0 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 12 39 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 29 30 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 10 25 96
Total protein-coding genes (size: 11418 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.7%)
Alanine (Ala, A)
n = 257 (6.76%)
Serine (Ser, S)
n = 286 (7.52%)
Threonine (Thr, T)
n = 324 (8.52%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 180 (4.73%)
Leucine (Leu, L)
n = 602 (15.83%)
Isoleucine (Ile, I)
n = 321 (8.44%)
Methionine (Met, M)
n = 262 (6.89%)
Proline (Pro, P)
n = 196 (5.15%)
Phenylalanine (Phe, F)
n = 228 (5.99%)
Tyrosine (Tyr, Y)
n = 129 (3.39%)
Tryptophan (Trp, W)
n = 102 (2.68%)
Aspartic acid (Asp, D)
n = 69 (1.81%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 151 (3.97%)
Glutamine (Gln, Q)
n = 86 (2.26%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 180 216 63 86 297 48 84 74 12 30 30 95 25 91 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 6 18 44 110 84 19 34 47 117 19 42 76 69 9 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
102 143 22 45 65 101 20 15 40 52 77 9 24 53 98 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 79 18 29 40 92 7 6 11 45 4 1 0 6 2 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
820 942 1213 830
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 1008 739 1593
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
284 1188 1596 737

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.