Viewing data for Crocodylus intermedius


Scientific name Crocodylus intermedius
Common name Oronico crocodile
Maximum lifespan 21.80 years (Crocodylus intermedius@AnAge)

Total mtDNA (size: 16828 bases) GC AT G C A T
Base content (bases) 7193 9635 4712 2481 4216 5419
Base content per 1 kb (bases) 427 573 280 147 251 322
Base content (%) 42.7% 57.3%
Total protein-coding genes (size: 11391 bases) GC AT G C A T
Base content (bases) 4950 6441 3406 1544 2921 3520
Base content per 1 kb (bases) 435 565 299 136 256 309
Base content (%) 43.5% 56.5%
D-loop (size: 1100 bases) GC AT G C A T
Base content (bases) 348 752 212 136 331 421
Base content per 1 kb (bases) 316 684 193 124 301 383
Base content (%) 31.6% 68.4%
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 659 886 380 279 396 490
Base content per 1 kb (bases) 427 573 246 181 256 317
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2578 bases) GC AT G C A T
Base content (bases) 1150 1428 645 505 532 896
Base content per 1 kb (bases) 446 554 250 196 206 348
Base content (%) 44.6% 55.4%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 464 520 257 207 198 322
Base content per 1 kb (bases) 472 528 261 210 201 327
Base content (%) 47.2% 52.8%
16S rRNA gene (size: 1594 bases) GC AT G C A T
Base content (bases) 686 908 388 298 334 574
Base content per 1 kb (bases) 430 570 243 187 210 360
Base content (%) 43.0% 57.0%

ATP6 (size: 696 bases) GC AT G C A T
Base content (bases) 297 399 214 83 176 223
Base content per 1 kb (bases) 427 573 307 119 253 320
Base content (%) 42.7% 57.3%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 53 109 42 11 40 69
Base content per 1 kb (bases) 327 673 259 68 247 426
Base content (%) 32.7% 67.3%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 658 899 408 250 442 457
Base content per 1 kb (bases) 423 577 262 161 284 294
Base content (%) 42.3% 57.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 285 399 190 95 170 229
Base content per 1 kb (bases) 417 583 278 139 249 335
Base content (%) 41.7% 58.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 352 432 225 127 215 217
Base content per 1 kb (bases) 449 551 287 162 274 277
Base content (%) 44.9% 55.1%
CYTB (size: 1165 bases) GC AT G C A T
Base content (bases) 511 654 358 153 298 356
Base content per 1 kb (bases) 439 561 307 131 256 306
Base content (%) 43.9% 56.1%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 433 530 282 151 262 268
Base content per 1 kb (bases) 450 550 293 157 272 278
Base content (%) 45.0% 55.0%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 470 586 343 127 266 320
Base content per 1 kb (bases) 445 555 325 120 252 303
Base content (%) 44.5% 55.5%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 157 191 101 56 91 100
Base content per 1 kb (bases) 451 549 290 161 261 287
Base content (%) 45.1% 54.9%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 594 780 413 181 351 429
Base content per 1 kb (bases) 432 568 301 132 255 312
Base content (%) 43.2% 56.8%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 131 163 96 35 86 77
Base content per 1 kb (bases) 446 554 327 119 293 262
Base content (%) 44.6% 55.4%
ND5 (size: 1860 bases) GC AT G C A T
Base content (bases) 812 1048 579 233 456 592
Base content per 1 kb (bases) 437 563 311 125 245 318
Base content (%) 43.7% 56.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 235 293 180 55 82 211
Base content per 1 kb (bases) 445 555 341 104 155 400
Base content (%) 44.5% 55.5%

ATP6 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.03%)
Alanine (Ala, A)
n = 19 (8.23%)
Serine (Ser, S)
n = 12 (5.19%)
Threonine (Thr, T)
n = 26 (11.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.9%)
Leucine (Leu, L)
n = 62 (26.84%)
Isoleucine (Ile, I)
n = 18 (7.79%)
Methionine (Met, M)
n = 11 (4.76%)
Proline (Pro, P)
n = 15 (6.49%)
Phenylalanine (Phe, F)
n = 5 (2.16%)
Tyrosine (Tyr, Y)
n = 4 (1.73%)
Tryptophan (Trp, W)
n = 4 (1.73%)
Aspartic acid (Asp, D)
n = 2 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.73%)
Asparagine (Asn, N)
n = 12 (5.19%)
Glutamine (Gln, Q)
n = 7 (3.03%)
Histidine (His, H)
n = 4 (1.73%)
Lysine (Lys, K)
n = 6 (2.6%)
Arginine (Arg, R)
n = 4 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 8 6 9 25 11 8 6 1 0 0 6 3 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 6 2 0 3 3 1 3 1 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 3 2 5 1 0 1 3 1 0 3 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 2 6 0 0 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 81 74 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 71 40 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 62 109 35
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMILSTTWLVFIITLQPKIASMKFMNNPSNPNQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 3 (5.66%)
Threonine (Thr, T)
n = 6 (11.32%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 5 (9.43%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 4 (7.55%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 2 (3.77%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 5 (9.43%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 0 0 1 0 4 4 0 0 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 1 1 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 1 0 0 0 1 0 0 1 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 4 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 13 25 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 12 29 10
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 47 (9.07%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 12 (2.32%)
Histidine (His, H)
n = 16 (3.09%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 17 24 9 11 21 3 6 11 1 9 7 20 3 20 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 7 16 12 1 5 8 22 8 3 6 21 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 1 2 8 16 1 0 8 7 10 0 4 6 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 2 6 8 10 0 1 1 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 111 147 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 97 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 164 213 110
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 10 2 5 17 2 5 7 3 3 4 6 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 2 5 1 1 1 3 3 3 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 1 2 4 6 0 1 3 6 3 1 0 2 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 0 2 8 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 65 66 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 68 100 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 10 5 3 14 4 8 6 0 5 5 4 1 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 11 3 1 3 7 5 3 2 0 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 0 1 7 1 0 7 7 4 4 0 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 3 1 0 0 0 5 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 67 65 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 52 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 93 100 50
CYTB (size: 1165 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.46%)
Alanine (Ala, A)
n = 27 (6.98%)
Serine (Ser, S)
n = 25 (6.46%)
Threonine (Thr, T)
n = 26 (6.72%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 14 (3.62%)
Leucine (Leu, L)
n = 67 (17.31%)
Isoleucine (Ile, I)
n = 30 (7.75%)
Methionine (Met, M)
n = 19 (4.91%)
Proline (Pro, P)
n = 25 (6.46%)
Phenylalanine (Phe, F)
n = 28 (7.24%)
Tyrosine (Tyr, Y)
n = 16 (4.13%)
Tryptophan (Trp, W)
n = 12 (3.1%)
Aspartic acid (Asp, D)
n = 11 (2.84%)
Glutamic acid (Glu, E)
n = 6 (1.55%)
Asparagine (Asn, N)
n = 16 (4.13%)
Glutamine (Gln, Q)
n = 8 (2.07%)
Histidine (His, H)
n = 12 (3.1%)
Lysine (Lys, K)
n = 9 (2.33%)
Arginine (Arg, R)
n = 11 (2.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 21 14 6 11 32 5 13 7 1 2 2 10 0 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 12 11 0 1 3 19 2 2 5 16 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 4 7 11 1 0 2 2 14 0 0 1 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 3 8 9 0 0 3 6 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 110 102 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 101 78 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 147 176 46
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 28 (8.75%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 29 (9.06%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 17 (5.31%)
Leucine (Leu, L)
n = 65 (20.31%)
Isoleucine (Ile, I)
n = 24 (7.5%)
Methionine (Met, M)
n = 12 (3.75%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 19 (5.94%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 15 11 6 4 26 12 14 5 1 5 6 4 2 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 11 12 1 3 7 3 3 2 7 7 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 13 3 4 3 10 3 4 1 4 7 1 3 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 3 0 3 6 1 0 2 3 2 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 82 89 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 95 51 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 105 128 49
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.42%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 29 (8.26%)
Threonine (Thr, T)
n = 44 (12.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 34 (9.69%)
Methionine (Met, M)
n = 14 (3.99%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 15 (4.27%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 7 (1.99%)
Asparagine (Asn, N)
n = 12 (3.42%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 14 9 10 13 29 6 7 12 3 2 3 4 5 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 20 8 1 0 5 5 2 0 5 11 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 1 6 13 5 2 0 3 4 5 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 3 0 1 12 0 0 1 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 99 119 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 124 141 56
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.42%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 29 (8.26%)
Threonine (Thr, T)
n = 44 (12.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 34 (9.69%)
Methionine (Met, M)
n = 14 (3.99%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 15 (4.27%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 7 (1.99%)
Asparagine (Asn, N)
n = 12 (3.42%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 14 9 10 13 29 6 7 12 3 2 3 4 5 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 20 8 1 0 5 5 2 0 5 11 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 1 6 13 5 2 0 3 4 5 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 3 0 1 12 0 0 1 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 99 119 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 124 141 56
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 30 (6.56%)
Serine (Ser, S)
n = 40 (8.75%)
Threonine (Thr, T)
n = 55 (12.04%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.5%)
Leucine (Leu, L)
n = 91 (19.91%)
Isoleucine (Ile, I)
n = 35 (7.66%)
Methionine (Met, M)
n = 34 (7.44%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 11 (2.41%)
Glutamine (Gln, Q)
n = 18 (3.94%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 12 25 10 11 45 7 15 16 2 2 2 9 3 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 5 1 17 11 1 2 8 8 3 1 9 10 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 20 6 3 13 12 2 3 7 4 9 3 3 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 2 0 6 8 0 1 0 7 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 132 153 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 137 75 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 144 201 69
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 6 (6.19%)
Methionine (Met, M)
n = 4 (4.12%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 7 (7.22%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 2 1 5 11 2 3 1 0 0 1 0 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 5 1 0 0 3 1 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 3 1 4 2 0 0 0 0 1 1 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 27 29 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 38 33 18
ND5 (size: 1860 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.04%)
Alanine (Ala, A)
n = 53 (8.56%)
Serine (Ser, S)
n = 59 (9.53%)
Threonine (Thr, T)
n = 66 (10.66%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 19 (3.07%)
Leucine (Leu, L)
n = 100 (16.16%)
Isoleucine (Ile, I)
n = 59 (9.53%)
Methionine (Met, M)
n = 35 (5.65%)
Proline (Pro, P)
n = 30 (4.85%)
Phenylalanine (Phe, F)
n = 29 (4.68%)
Tyrosine (Tyr, Y)
n = 18 (2.91%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 13 (2.1%)
Glutamic acid (Glu, E)
n = 15 (2.42%)
Asparagine (Asn, N)
n = 22 (3.55%)
Glutamine (Gln, Q)
n = 20 (3.23%)
Histidine (His, H)
n = 12 (1.94%)
Lysine (Lys, K)
n = 24 (3.88%)
Arginine (Arg, R)
n = 9 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 33 26 11 13 48 12 13 18 2 3 5 9 2 10 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 7 27 17 2 2 8 11 4 3 9 17 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 22 2 5 16 21 2 1 14 6 12 2 3 5 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 4 3 10 21 3 0 3 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 155 221 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 193 125 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 231 246 95
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 13 (7.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 5 (2.86%)
Cysteine (Cys, C)
n = 7 (4.0%)
Valine (Val, V)
n = 26 (14.86%)
Leucine (Leu, L)
n = 26 (14.86%)
Isoleucine (Ile, I)
n = 6 (3.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 4 (2.29%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 4 4 1 4 1 7 0 0 10 1 4 11 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 7 0 7 1 3 2 6 5 4 13 0 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 3 0 1 1 6 1 7 0 4 9 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 1 1 1 2 0 2 0 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 17 29 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 24 21 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 14 32 78
Total protein-coding genes (size: 11471 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.55%)
Alanine (Ala, A)
n = 290 (7.59%)
Serine (Ser, S)
n = 288 (7.54%)
Threonine (Thr, T)
n = 360 (9.42%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 190 (4.97%)
Leucine (Leu, L)
n = 648 (16.95%)
Isoleucine (Ile, I)
n = 297 (7.77%)
Methionine (Met, M)
n = 204 (5.34%)
Proline (Pro, P)
n = 203 (5.31%)
Phenylalanine (Phe, F)
n = 219 (5.73%)
Tyrosine (Tyr, Y)
n = 117 (3.06%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 72 (1.88%)
Glutamic acid (Glu, E)
n = 92 (2.41%)
Asparagine (Asn, N)
n = 131 (3.43%)
Glutamine (Gln, Q)
n = 109 (2.85%)
Histidine (His, H)
n = 92 (2.41%)
Lysine (Lys, K)
n = 89 (2.33%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
144 153 149 74 88 286 68 106 95 14 41 38 79 32 84 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 14 14 46 138 94 12 24 59 86 43 21 48 121 13 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
137 155 16 37 70 100 16 15 50 52 65 18 26 29 102 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 70 22 19 53 84 5 4 17 45 5 0 2 8 1 82
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
856 991 1148 828
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
478 1076 711 1558
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
348 1239 1560 676

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.