Viewing data for Zalophus californianus


Scientific name Zalophus californianus
Common name California sea lion
Maximum lifespan 35.70 years (Zalophus californianus@AnAge)

Total mtDNA (size: 16677 bases) GC AT G C A T
Base content (bases) 6736 9941 4442 2294 4340 5601
Base content per 1 kb (bases) 404 596 266 138 260 336
Base content (%) 40.4% 59.6%
Total protein-coding genes (size: 11345 bases) GC AT G C A T
Base content (bases) 4650 6695 3221 1429 3016 3679
Base content per 1 kb (bases) 410 590 284 126 266 324
Base content (%) 41.0% 59.0%
D-loop (size: 1216 bases) GC AT G C A T
Base content (bases) 487 729 317 170 324 405
Base content per 1 kb (bases) 400 600 261 140 266 333
Base content (%) 40.0% 60.0%
Total tRNA-coding genes (size: 1519 bases) GC AT G C A T
Base content (bases) 580 939 334 246 405 534
Base content per 1 kb (bases) 382 618 220 162 267 352
Base content (%) 38.2% 61.8%
Total rRNA-coding genes (size: 2541 bases) GC AT G C A T
Base content (bases) 994 1547 554 440 586 961
Base content per 1 kb (bases) 391 609 218 173 231 378
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 962 bases) GC AT G C A T
Base content (bases) 394 568 226 168 215 353
Base content per 1 kb (bases) 410 590 235 175 223 367
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 600 979 328 272 371 608
Base content per 1 kb (bases) 380 620 208 172 235 385
Base content (%) 38.0% 62.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 281 400 206 75 188 212
Base content per 1 kb (bases) 413 587 302 110 276 311
Base content (%) 41.3% 58.7%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 68 136 54 14 54 82
Base content per 1 kb (bases) 333 667 265 69 265 402
Base content (%) 33.3% 66.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 667 878 397 270 450 428
Base content per 1 kb (bases) 432 568 257 175 291 277
Base content (%) 43.2% 56.8%
COX2 (size: 682 bases) GC AT G C A T
Base content (bases) 262 420 169 93 189 231
Base content per 1 kb (bases) 384 616 248 136 277 339
Base content (%) 38.4% 61.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 349 435 234 115 212 223
Base content per 1 kb (bases) 445 555 298 147 270 284
Base content (%) 44.5% 55.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 492 648 342 150 297 351
Base content per 1 kb (bases) 432 568 300 132 261 308
Base content (%) 43.2% 56.8%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 406 551 286 120 255 296
Base content per 1 kb (bases) 424 576 299 125 266 309
Base content (%) 42.4% 57.6%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 387 657 293 94 265 392
Base content per 1 kb (bases) 371 629 281 90 254 375
Base content (%) 37.1% 62.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 142 204 101 41 92 112
Base content per 1 kb (bases) 410 590 292 118 266 324
Base content (%) 41.0% 59.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 552 826 401 151 369 457
Base content per 1 kb (bases) 401 599 291 110 268 332
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 120 177 84 36 88 89
Base content per 1 kb (bases) 404 596 283 121 296 300
Base content (%) 40.4% 59.6%
ND5 (size: 1827 bases) GC AT G C A T
Base content (bases) 739 1088 520 219 479 609
Base content per 1 kb (bases) 404 596 285 120 262 333
Base content (%) 40.4% 59.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 208 320 152 56 98 222
Base content per 1 kb (bases) 394 606 288 106 186 420
Base content (%) 39.4% 60.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 12 4 7 18 3 11 8 1 0 2 6 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 11 4 0 2 3 7 0 4 5 4 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 1 4 2 4 1 0 4 0 2 1 1 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 1 0 3 1 0 1 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 65 82 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 76 93 46
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTTIVSMILTLFIVFQLKISKHHFPMSPELKPLSTSKTNIPWEKKWTKIYSPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 2 2 0 4 0 2 3 0 0 0 2 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 2 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 2 5 0 0 1 1 0 1 1 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 7 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 18 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 14 38 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 43 (8.37%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 21 7 5 29 5 13 5 1 4 8 20 4 15 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 1 10 12 14 4 7 13 22 5 9 11 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 5 10 8 8 2 1 3 10 8 0 1 9 7 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 3 4 11 8 1 0 1 7 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 106 138 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 134 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 157 196 118
COX2 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 9 (3.98%)
Serine (Ser, S)
n = 19 (8.41%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 3 (1.33%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 29 (12.83%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 17 (7.52%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 6 (2.65%)
Tyrosine (Tyr, Y)
n = 10 (4.42%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 10 (4.42%)
Glutamic acid (Glu, E)
n = 15 (6.64%)
Asparagine (Asn, N)
n = 6 (2.65%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 14 7 0 14 1 7 7 0 1 3 8 1 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 4 1 1 2 2 4 0 5 3 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 2 3 5 7 1 1 2 6 4 1 0 3 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 12 3 3 7 5 0 1 0 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 55 70 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 56 101 57
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 7 5 3 21 1 4 7 0 1 4 8 1 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 6 4 0 0 9 10 1 5 3 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 2 5 9 1 0 4 6 5 2 1 2 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 1 2 2 1 1 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 70 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 97 105 46
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 26 12 4 13 28 5 7 6 0 2 6 8 0 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 4 10 11 0 0 6 16 3 2 7 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 0 2 6 15 0 1 2 7 8 0 1 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 1 10 9 0 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 98 113 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 98 75 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 146 163 57
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 26 (8.18%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 28 (8.81%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 28 (8.81%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 18 (5.66%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 12 2 9 36 5 5 5 1 3 1 9 0 3 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 11 8 1 2 2 6 2 4 9 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 1 5 12 0 2 1 7 5 1 1 7 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 0 3 6 1 1 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 92 97 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 94 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 100 143 54
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 29 4 9 35 4 5 9 0 0 2 7 1 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 3 10 0 1 3 11 1 3 11 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 1 4 6 15 0 1 1 2 6 0 0 5 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 13 1 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 93 142 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 62 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 95 188 53
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 29 4 9 35 4 5 9 0 0 2 7 1 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 3 10 0 1 3 11 1 3 11 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 1 4 6 15 0 1 1 2 6 0 0 5 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 13 1 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 93 142 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 62 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 95 188 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 34 12 11 52 4 16 10 1 0 1 10 3 4 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 4 14 12 2 2 6 7 2 4 14 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 2 9 12 1 2 10 7 9 0 1 9 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 3 0 3 13 0 1 4 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 135 162 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 120 83 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 146 212 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 10 3 5 10 0 2 2 0 0 0 7 1 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 3 1 1 0 1 3 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 2 5 2 0 0 1 2 2 0 0 0 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 24 28 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 18 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 38 43 13
ND5 (size: 1827 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.77%)
Alanine (Ala, A)
n = 41 (6.74%)
Serine (Ser, S)
n = 49 (8.06%)
Threonine (Thr, T)
n = 60 (9.87%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 18 (2.96%)
Leucine (Leu, L)
n = 92 (15.13%)
Isoleucine (Ile, I)
n = 57 (9.38%)
Methionine (Met, M)
n = 44 (7.24%)
Proline (Pro, P)
n = 26 (4.28%)
Phenylalanine (Phe, F)
n = 42 (6.91%)
Tyrosine (Tyr, Y)
n = 16 (2.63%)
Tryptophan (Trp, W)
n = 12 (1.97%)
Aspartic acid (Asp, D)
n = 12 (1.97%)
Glutamic acid (Glu, E)
n = 12 (1.97%)
Asparagine (Asn, N)
n = 30 (4.93%)
Glutamine (Gln, Q)
n = 17 (2.8%)
Histidine (His, H)
n = 16 (2.63%)
Lysine (Lys, K)
n = 22 (3.62%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 34 38 6 15 48 10 11 14 3 3 3 10 2 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 7 17 14 3 4 8 17 0 3 7 16 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 25 3 3 10 20 4 3 9 5 11 1 2 14 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 2 4 8 19 3 2 1 4 2 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 147 225 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 164 126 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 209 258 101
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 11 (6.29%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 6 (3.43%)
Glutamic acid (Glu, E)
n = 7 (4.0%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 1 3 3 1 3 1 8 1 0 11 2 4 8 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 4 3 0 4 14 1 6 4 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 6 1 0 1 5 0 8 1 3 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 6 4 2 1 2 1 0 0 0 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 13 38 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 30 30 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 13 30 92
Total protein-coding genes (size: 11413 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.73%)
Alanine (Ala, A)
n = 250 (6.58%)
Serine (Ser, S)
n = 285 (7.5%)
Threonine (Thr, T)
n = 333 (8.76%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 179 (4.71%)
Leucine (Leu, L)
n = 605 (15.91%)
Isoleucine (Ile, I)
n = 323 (8.5%)
Methionine (Met, M)
n = 253 (6.65%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 227 (5.97%)
Tyrosine (Tyr, Y)
n = 125 (3.29%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 151 (3.97%)
Glutamine (Gln, Q)
n = 85 (2.24%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
143 180 200 61 82 315 39 93 78 7 25 32 101 21 81 146
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
53 3 21 51 97 85 17 34 54 112 18 44 77 77 2 60
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
110 147 16 41 66 110 12 17 39 61 64 10 15 62 89 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 76 22 19 51 88 11 8 8 44 4 1 0 6 2 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
815 948 1216 824
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
466 1012 738 1587
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
249 1183 1626 745

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.