Viewing data for Balaenoptera borealis


Scientific name Balaenoptera borealis
Common name Sei whale
Maximum lifespan 74.00 years (Balaenoptera borealis@AnAge)

Total mtDNA (size: 16410 bases) GC AT G C A T
Base content (bases) 6633 9777 4494 2139 4385 5392
Base content per 1 kb (bases) 404 596 274 130 267 329
Base content (%) 40.4% 59.6%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4673 6677 3367 1306 3050 3627
Base content per 1 kb (bases) 412 588 297 115 269 320
Base content (%) 41.2% 58.8%
D-loop (size: 934 bases) GC AT G C A T
Base content (bases) 357 577 217 140 295 282
Base content per 1 kb (bases) 382 618 232 150 316 302
Base content (%) 38.2% 61.8%
Total tRNA-coding genes (size: 1523 bases) GC AT G C A T
Base content (bases) 554 969 324 230 430 539
Base content per 1 kb (bases) 364 636 213 151 282 354
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2555 bases) GC AT G C A T
Base content (bases) 1024 1531 569 455 602 929
Base content per 1 kb (bases) 401 599 223 178 236 364
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 419 557 237 182 211 346
Base content per 1 kb (bases) 429 571 243 186 216 355
Base content (%) 42.9% 57.1%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 605 974 332 273 391 583
Base content per 1 kb (bases) 383 617 210 173 248 369
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 192 69 208 212
Base content per 1 kb (bases) 383 617 282 101 305 311
Base content (%) 38.3% 61.7%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 66 126 55 11 55 71
Base content per 1 kb (bases) 344 656 286 57 286 370
Base content (%) 34.4% 65.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 645 906 395 250 458 448
Base content per 1 kb (bases) 416 584 255 161 295 289
Base content (%) 41.6% 58.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 273 411 186 87 170 241
Base content per 1 kb (bases) 399 601 272 127 249 352
Base content (%) 39.9% 60.1%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 340 446 231 109 223 223
Base content per 1 kb (bases) 433 567 294 139 284 284
Base content (%) 43.3% 56.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 505 635 354 151 292 343
Base content per 1 kb (bases) 443 557 311 132 256 301
Base content (%) 44.3% 55.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 394 563 287 107 252 311
Base content per 1 kb (bases) 412 588 300 112 263 325
Base content (%) 41.2% 58.8%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 406 638 324 82 261 377
Base content per 1 kb (bases) 389 611 310 79 250 361
Base content (%) 38.9% 61.1%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 146 201 106 40 92 109
Base content per 1 kb (bases) 421 579 305 115 265 314
Base content (%) 42.1% 57.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 573 805 434 139 368 437
Base content per 1 kb (bases) 416 584 315 101 267 317
Base content (%) 41.6% 58.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 86 40 90 81
Base content per 1 kb (bases) 424 576 290 135 303 273
Base content (%) 42.4% 57.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 750 1071 558 192 502 569
Base content per 1 kb (bases) 412 588 306 105 276 312
Base content (%) 41.2% 58.8%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 205 323 169 36 98 225
Base content per 1 kb (bases) 388 612 320 68 186 426
Base content (%) 38.8% 61.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 10 10 4 15 2 10 8 0 1 3 6 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 2 0 4 1 4 0 5 4 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 1 4 4 0 2 2 0 2 1 0 6 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 1 0 4 1 2 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 64 86 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 67 39 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 61 87 69
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMFLALFMLFQLKISKHSYSPSPKLVFTKTQKQQTPWNTTWTKIYLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.59%)
Serine (Ser, S)
n = 6 (9.52%)
Threonine (Thr, T)
n = 9 (14.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.59%)
Leucine (Leu, L)
n = 12 (19.05%)
Isoleucine (Ile, I)
n = 3 (4.76%)
Methionine (Met, M)
n = 3 (4.76%)
Proline (Pro, P)
n = 5 (7.94%)
Phenylalanine (Phe, F)
n = 4 (6.35%)
Tyrosine (Tyr, Y)
n = 2 (3.17%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.59%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 1 (1.59%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 2 2 2 0 5 5 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 1 3 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 2 2 0 0 1 1 1 0 1 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 23 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 17 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 31 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 39 (7.56%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 36 (6.98%)
Methionine (Met, M)
n = 32 (6.2%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 24 8 3 32 1 16 6 0 7 12 15 5 10 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 6 15 18 0 15 10 18 5 12 8 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 21 1 5 7 16 0 2 1 8 10 0 0 9 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 1 4 11 9 0 1 2 5 0 1 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 104 139 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 156 216 124
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 14 2 5 20 0 7 6 0 2 3 8 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 4 4 0 0 5 3 0 0 6 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 3 3 3 9 0 2 3 5 4 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 1 3 8 5 0 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 59 67 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 72 115 35
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 14 (5.36%)
Serine (Ser, S)
n = 21 (8.05%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 8 4 7 15 0 7 7 0 3 3 10 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 9 3 0 1 11 7 1 5 3 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 5 2 10 0 0 4 4 7 0 0 1 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 2 1 2 1 1 1 3 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 67 61 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 57 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 99 105 53
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 30 (7.92%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 34 (8.97%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 12 3 13 34 2 7 6 0 5 8 5 2 9 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 8 17 0 4 13 7 0 2 8 13 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 0 2 7 8 0 1 3 3 13 1 0 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 3 9 9 1 0 1 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 102 108 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 96 76 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 156 159 55
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 31 (9.75%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 14 (4.4%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 19 4 10 34 1 8 7 0 0 1 10 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 14 14 0 1 6 4 1 3 10 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 2 8 8 0 1 2 5 7 1 0 4 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 7 0 0 1 7 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 90 92 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 94 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 103 160 50
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 32 4 13 38 1 8 11 0 1 1 4 0 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 10 7 0 1 6 6 1 3 8 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 2 1 10 10 0 1 2 5 6 0 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 96 141 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 56 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 118 180 45
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 21 (6.05%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 32 (9.22%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 32 4 13 38 1 8 11 0 1 1 4 0 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 10 7 0 1 6 6 1 3 8 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 2 1 10 10 0 1 2 5 6 0 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 12 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 96 141 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 56 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 118 180 45
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 26 27 13 24 47 3 11 10 0 0 7 7 0 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 6 12 12 1 0 8 8 1 4 12 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 2 15 10 0 1 9 7 8 0 0 10 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 1 0 3 12 0 1 3 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 145 155 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 118 85 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 171 197 79
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 8 2 7 10 0 3 2 0 0 4 1 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 5 1 4 0 1 2 0 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 4 2 0 2 0 1 2 0 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 26 28 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 23 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 37 36 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 45 (7.43%)
Serine (Ser, S)
n = 44 (7.26%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 102 (16.83%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 32 (5.28%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 33 29 15 26 38 6 16 20 1 2 4 7 0 15 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 7 22 16 0 2 7 16 2 7 14 9 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 26 0 8 15 9 1 5 6 8 10 0 1 12 22 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 2 4 8 18 3 2 3 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 157 210 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 167 130 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 234 229 124
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 10 (5.71%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 28 (16.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 6 (3.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 8 (4.57%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 3 0 0 1 0 8 0 1 14 1 3 10 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 6 0 3 1 12 0 3 12 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 4 0 1 1 7 0 7 1 4 9 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 3 0 0 4 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 7 42 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 26 28 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 3 28 92
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 263 (6.92%)
Serine (Ser, S)
n = 265 (6.97%)
Threonine (Thr, T)
n = 332 (8.74%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 181 (4.76%)
Leucine (Leu, L)
n = 629 (16.55%)
Isoleucine (Ile, I)
n = 313 (8.24%)
Methionine (Met, M)
n = 225 (5.92%)
Proline (Pro, P)
n = 206 (5.42%)
Phenylalanine (Phe, F)
n = 240 (6.32%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 154 (4.05%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
154 159 193 71 119 299 17 111 91 2 35 47 80 19 94 146
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 8 15 46 112 103 2 41 70 78 24 47 80 77 2 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
108 163 12 34 79 90 3 24 35 57 71 7 12 54 100 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 81 13 22 46 85 11 7 15 41 2 2 0 7 2 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 967 1181 834
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 1007 739 1588
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
160 1270 1599 772

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.