Viewing data for Carduelis spinus


Scientific name Carduelis spinus
Common name Eurasian siskin
Maximum lifespan 13.50 years (Carduelis spinus@AnAge)

Total mtDNA (size: 16828 bases) GC AT G C A T
Base content (bases) 7581 9247 5261 2320 4030 5217
Base content per 1 kb (bases) 450 550 313 138 239 310
Base content (%) 45.0% 55.0%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5216 6162 3848 1368 2705 3457
Base content per 1 kb (bases) 458 542 338 120 238 304
Base content (%) 45.8% 54.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1539 bases) GC AT G C A T
Base content (bases) 633 906 371 262 392 514
Base content per 1 kb (bases) 411 589 241 170 255 334
Base content (%) 41.1% 58.9%
Total rRNA-coding genes (size: 2573 bases) GC AT G C A T
Base content (bases) 1167 1406 646 521 553 853
Base content per 1 kb (bases) 454 546 251 202 215 332
Base content (%) 45.4% 54.6%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 471 505 268 203 203 302
Base content per 1 kb (bases) 483 517 275 208 208 309
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1597 bases) GC AT G C A T
Base content (bases) 696 901 378 318 350 551
Base content per 1 kb (bases) 436 564 237 199 219 345
Base content (%) 43.6% 56.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 244 67 167 206
Base content per 1 kb (bases) 455 545 357 98 244 301
Base content (%) 45.5% 54.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 62 11 43 52
Base content per 1 kb (bases) 435 565 369 65 256 310
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 721 830 477 244 392 438
Base content per 1 kb (bases) 465 535 308 157 253 282
Base content (%) 46.5% 53.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 212 99 159 214
Base content per 1 kb (bases) 455 545 310 145 232 313
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 377 407 258 119 184 223
Base content per 1 kb (bases) 481 519 329 152 235 284
Base content (%) 48.1% 51.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 535 608 390 145 278 330
Base content per 1 kb (bases) 468 532 341 127 243 289
Base content (%) 46.8% 53.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 433 545 309 124 260 285
Base content per 1 kb (bases) 443 557 316 127 266 291
Base content (%) 44.3% 55.7%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 454 586 354 100 258 328
Base content per 1 kb (bases) 437 563 340 96 248 315
Base content (%) 43.7% 56.3%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 157 194 117 40 93 101
Base content per 1 kb (bases) 447 553 333 114 265 288
Base content (%) 44.7% 55.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 619 759 481 138 328 431
Base content per 1 kb (bases) 449 551 349 100 238 313
Base content (%) 44.9% 55.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 110 36 71 80
Base content per 1 kb (bases) 492 508 370 121 239 269
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 837 981 634 203 414 567
Base content per 1 kb (bases) 460 540 349 112 228 312
Base content (%) 46.0% 54.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 247 272 203 44 62 210
Base content per 1 kb (bases) 476 524 391 85 119 405
Base content (%) 47.6% 52.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 7 3 15 36 2 5 6 2 1 2 5 1 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 9 3 0 2 4 2 0 2 4 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 0 1 5 4 1 1 2 0 3 0 0 0 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 87 67 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 91 104 25
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKILTFVTMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 7 (12.73%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 6 1 1 2 1 0 0 2 0 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 2 5 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 2 1 0 0 1 0 0 0 0 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 23 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 22 21 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 20 6 14 38 0 4 9 0 5 14 18 3 6 37
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 9 18 18 0 10 9 26 2 6 10 15 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 1 4 9 11 0 0 4 2 15 0 0 4 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 10 0 3 12 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 125 129 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 215 215 78
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 10 2 9 13 1 4 6 0 3 4 9 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 6 5 5 0 1 2 5 0 3 3 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 2 4 6 6 0 0 5 0 7 0 0 1 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 12 0 1 12 4 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 59 58 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 59 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 92 97 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 5 1 5 23 1 3 7 1 4 2 8 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 14 7 0 0 7 11 1 3 3 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 4 4 4 0 0 6 3 7 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 0 1 3 4 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 74 56 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 113 113 29
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 24 (6.32%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 25 6 5 17 36 2 3 8 0 5 7 12 0 2 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 3 17 8 0 3 9 11 1 3 8 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 5 6 9 1 0 1 0 12 0 0 2 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 8 10 0 3 2 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 112 99 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 179 152 44
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 8 6 17 35 2 6 6 0 2 2 11 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 8 5 18 0 0 7 6 1 1 11 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 5 1 7 5 7 0 0 6 10 6 0 0 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 3 7 0 2 1 5 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 101 81 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 94 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 114 145 58
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 23 12 6 17 34 5 4 8 2 2 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 9 11 0 1 5 7 0 7 5 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 14 1 5 11 11 1 2 4 1 6 0 0 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 105 126 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 116 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 133 144 56
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 34 (9.86%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 23 12 6 17 34 5 4 8 2 2 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 9 11 0 1 5 7 0 7 5 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 14 1 5 11 11 1 2 4 1 6 0 0 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 2 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 105 126 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 116 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 133 144 56
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 38 25 10 31 38 2 16 14 0 2 3 4 0 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 10 16 15 1 2 6 9 0 4 11 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 18 0 5 10 12 0 0 10 2 11 0 0 1 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 0 1 1 9 1 0 1 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 147 148 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 136 79 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 198 204 52
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 6 3 3 11 2 0 3 0 0 1 0 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 5 2 0 1 2 1 0 1 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 1 5 3 0 0 4 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 48 36 11
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 50 (8.26%)
Threonine (Thr, T)
n = 64 (10.58%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 104 (17.19%)
Isoleucine (Ile, I)
n = 54 (8.93%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 43 28 4 27 67 2 4 13 3 4 6 7 1 6 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 5 8 26 16 0 0 12 19 2 7 18 6 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 22 0 3 19 18 0 0 10 0 12 0 0 5 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 0 2 7 20 0 0 2 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
122 168 207 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 185 109 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 281 251 63
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 13 (7.56%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 33 (19.19%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 5 0 0 0 15 0 0 15 0 3 16 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 0 2 5 11 0 5 15 1 0 0 3 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 0 4 3 0 7 0 3 13 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 0 0 0 0 0 0 4 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 13 15 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 18 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 3 29 67
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 306 (8.06%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 316 (8.32%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 194 (5.11%)
Leucine (Leu, L)
n = 666 (17.54%)
Isoleucine (Ile, I)
n = 305 (8.03%)
Methionine (Met, M)
n = 161 (4.24%)
Proline (Pro, P)
n = 225 (5.93%)
Phenylalanine (Phe, F)
n = 217 (5.72%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 132 (3.48%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
79 226 135 54 164 348 20 67 85 8 43 45 83 23 40 177
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 4 24 65 127 108 6 31 65 104 23 41 81 98 5 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
135 122 7 46 85 89 7 6 54 26 83 3 13 22 110 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
93 88 6 11 54 84 1 6 16 44 5 1 2 6 1 103
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
882 1079 1062 774
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
491 1074 689 1543
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
156 1539 1565 537

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.