Viewing data for Branta canadensis


Scientific name Branta canadensis
Common name Canada goose
Maximum lifespan 42.00 years (Branta canadensis@AnAge)

Total mtDNA (size: 16760 bases) GC AT G C A T
Base content (bases) 7913 8847 5375 2538 3788 5059
Base content per 1 kb (bases) 472 528 321 151 226 302
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11390 bases) GC AT G C A T
Base content (bases) 5493 5897 3910 1583 2572 3325
Base content per 1 kb (bases) 482 518 343 139 226 292
Base content (%) 48.2% 51.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1537 bases) GC AT G C A T
Base content (bases) 651 886 390 261 375 511
Base content per 1 kb (bases) 424 576 254 170 244 332
Base content (%) 42.4% 57.6%
Total rRNA-coding genes (size: 2591 bases) GC AT G C A T
Base content (bases) 1210 1381 680 530 524 857
Base content per 1 kb (bases) 467 533 262 205 202 331
Base content (%) 46.7% 53.3%
12S rRNA gene (size: 985 bases) GC AT G C A T
Base content (bases) 476 509 272 204 195 314
Base content per 1 kb (bases) 483 517 276 207 198 319
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1606 bases) GC AT G C A T
Base content (bases) 734 872 408 326 329 543
Base content per 1 kb (bases) 457 543 254 203 205 338
Base content (%) 45.7% 54.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 322 362 253 69 161 201
Base content per 1 kb (bases) 471 529 370 101 235 294
Base content (%) 47.1% 52.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 74 94 60 14 35 59
Base content per 1 kb (bases) 440 560 357 83 208 351
Base content (%) 44.0% 56.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 771 780 505 266 366 414
Base content per 1 kb (bases) 497 503 326 172 236 267
Base content (%) 49.7% 50.3%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 339 348 223 116 155 193
Base content per 1 kb (bases) 493 507 325 169 226 281
Base content (%) 49.3% 50.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 390 394 262 128 180 214
Base content per 1 kb (bases) 497 503 334 163 230 273
Base content (%) 49.7% 50.3%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 561 582 406 155 262 320
Base content per 1 kb (bases) 491 509 355 136 229 280
Base content (%) 49.1% 50.9%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 468 510 315 153 249 261
Base content per 1 kb (bases) 479 521 322 156 255 267
Base content (%) 47.9% 52.1%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 491 550 370 121 233 317
Base content per 1 kb (bases) 472 528 355 116 224 305
Base content (%) 47.2% 52.8%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 176 176 123 53 87 89
Base content per 1 kb (bases) 500 500 349 151 247 253
Base content (%) 50.0% 50.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 635 743 479 156 325 418
Base content per 1 kb (bases) 461 539 348 113 236 303
Base content (%) 46.1% 53.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 98 46 75 78
Base content per 1 kb (bases) 485 515 330 155 253 263
Base content (%) 48.5% 51.5%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 862 962 616 246 393 569
Base content per 1 kb (bases) 473 527 338 135 215 312
Base content (%) 47.3% 52.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 265 257 203 62 55 202
Base content per 1 kb (bases) 508 492 389 119 105 387
Base content (%) 50.8% 49.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 17 8 5 15 31 4 3 6 1 0 2 3 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 5 0 1 4 1 1 2 7 8 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 4 5 2 0 0 4 1 2 0 1 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 1 0 1 3 0 0 3 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 90 72 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 97 93 25
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALIIQPKLLAFTTTNPPSNKISLTTKPTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 2 1 1 4 1 0 2 0 0 1 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 0 2 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 1 0 1 3 0 0 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 2 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 22 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 9 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 17 28 6
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 35 17 3 15 31 10 5 9 1 4 15 16 1 12 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 4 31 10 1 3 14 25 5 4 13 12 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 11 4 2 10 10 2 0 3 1 16 0 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 8 2 2 13 9 0 0 1 7 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 126 132 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 240 187 55
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 13 (5.7%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 4 3 10 8 6 2 6 1 5 3 8 2 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 8 4 0 1 2 3 3 2 4 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 0 0 8 9 1 0 3 0 8 1 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 1 1 12 4 0 1 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 63 50 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 62 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 99 81 28
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 13 5 0 13 15 5 0 6 0 3 4 7 0 1 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 1 12 7 2 0 6 12 1 2 1 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 2 5 7 0 1 4 2 7 1 0 1 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 5 3 0 6 4 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 74 58 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 119 102 23
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 31 (8.16%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 29 9 6 13 35 7 2 6 2 0 3 13 1 1 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 5 4 21 6 0 2 6 12 3 5 8 12 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 6 1 1 8 13 0 1 1 1 12 2 1 0 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 1 8 10 0 0 3 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 114 97 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 102 78 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 190 145 27
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.62%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 60 (18.46%)
Isoleucine (Ile, I)
n = 18 (5.54%)
Methionine (Met, M)
n = 22 (6.77%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 9 (2.77%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 17 2 11 35 11 1 4 2 3 8 5 1 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 6 17 8 1 0 7 4 4 7 9 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 6 5 5 4 1 5 4 10 0 0 0 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 4 7 0 0 1 5 2 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 99 82 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 95 53 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 121 126 46
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 40 (11.56%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 15 3 17 30 5 7 7 2 1 4 6 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 22 9 3 0 7 4 0 4 6 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 2 11 7 3 0 7 1 7 0 1 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 2 14 0 1 1 1 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 99 113 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 149 145 33
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 40 (11.56%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 15 3 17 30 5 7 7 2 1 4 6 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 22 9 3 0 7 4 0 4 6 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 2 11 7 3 0 7 1 7 0 1 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 2 14 0 1 1 1 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 99 113 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 149 145 33
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 45 (9.83%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 27 (5.9%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 1 (0.22%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 30 19 9 15 59 4 9 11 1 2 4 4 1 2 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 5 15 11 0 0 10 6 5 2 12 13 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 15 2 4 12 15 0 0 8 0 14 0 3 0 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 0 0 1 10 0 1 3 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 153 143 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 136 73 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 190 202 41
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 5 1 2 12 2 0 2 0 0 2 3 1 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 4 2 0 0 4 1 1 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 1 4 5 1 0 3 0 1 0 1 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 29 22 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 26 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 43 39 9
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 60 (9.88%)
Serine (Ser, S)
n = 38 (6.26%)
Threonine (Thr, T)
n = 62 (10.21%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.13%)
Leucine (Leu, L)
n = 100 (16.47%)
Isoleucine (Ile, I)
n = 50 (8.24%)
Methionine (Met, M)
n = 35 (5.77%)
Proline (Pro, P)
n = 33 (5.44%)
Phenylalanine (Phe, F)
n = 34 (5.6%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.15%)
Glutamic acid (Glu, E)
n = 13 (2.14%)
Asparagine (Asn, N)
n = 27 (4.45%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 16 (2.64%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 41 29 2 23 53 14 6 18 1 1 6 6 6 9 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 6 10 33 16 1 1 8 19 5 1 12 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 20 0 3 12 11 3 0 9 2 9 3 2 4 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 3 1 6 22 1 1 2 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
132 169 206 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 184 117 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 263 246 54
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 31 (17.92%)
Leucine (Leu, L)
n = 22 (12.72%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 18 (10.4%)
Tyrosine (Tyr, Y)
n = 6 (3.47%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 1 1 1 4 4 0 0 10 3 5 13 16 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 2 6 0 2 8 6 0 2 19 3 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 3 0 2 5 0 0 3 3 2 11 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 2 0 0 1 0 0 0 5 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 17 18 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 33 18 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
82 12 19 61
Total protein-coding genes (size: 11408 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 330 (8.68%)
Serine (Ser, S)
n = 275 (7.23%)
Threonine (Thr, T)
n = 306 (8.05%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 192 (5.05%)
Leucine (Leu, L)
n = 647 (17.02%)
Isoleucine (Ile, I)
n = 281 (7.39%)
Methionine (Met, M)
n = 184 (4.84%)
Proline (Pro, P)
n = 229 (6.02%)
Phenylalanine (Phe, F)
n = 231 (6.08%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 64 (1.68%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 125 (3.29%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
57 224 131 39 145 326 76 40 81 11 30 56 77 29 60 171
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
53 2 29 50 180 84 16 14 69 92 48 34 76 113 6 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
137 112 11 28 83 94 19 3 48 15 91 10 21 16 109 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
99 77 18 7 57 85 4 4 17 43 9 0 2 7 2 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
904 1091 1038 769
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1089 691 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
335 1591 1459 417

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.