Viewing data for Betta splendens


Scientific name Betta splendens
Common name Siamese fighting fish
Maximum lifespan 2.00 years (Betta splendens@AnAge)

Total mtDNA (size: 16980 bases) GC AT G C A T
Base content (bases) 6468 10512 4048 2420 5170 5342
Base content per 1 kb (bases) 381 619 238 143 304 315
Base content (%) 38.1% 61.9%
Total protein-coding genes (size: 11440 bases) GC AT G C A T
Base content (bases) 4373 7067 2853 1520 3646 3421
Base content per 1 kb (bases) 382 618 249 133 319 299
Base content (%) 38.2% 61.8%
D-loop (size: 1198 bases) GC AT G C A T
Base content (bases) 303 895 184 119 438 457
Base content per 1 kb (bases) 253 747 154 99 366 381
Base content (%) 25.3% 74.7%
Total tRNA-coding genes (size: 1555 bases) GC AT G C A T
Base content (bases) 646 909 369 277 400 509
Base content per 1 kb (bases) 415 585 237 178 257 327
Base content (%) 41.5% 58.5%
Total rRNA-coding genes (size: 2656 bases) GC AT G C A T
Base content (bases) 1103 1553 609 494 646 907
Base content per 1 kb (bases) 415 585 229 186 243 341
Base content (%) 41.5% 58.5%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 415 541 223 192 239 302
Base content per 1 kb (bases) 434 566 233 201 250 316
Base content (%) 43.4% 56.6%
16S rRNA gene (size: 1700 bases) GC AT G C A T
Base content (bases) 688 1012 386 302 407 605
Base content per 1 kb (bases) 405 595 227 178 239 356
Base content (%) 40.5% 59.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 236 448 157 79 251 197
Base content per 1 kb (bases) 345 655 230 115 367 288
Base content (%) 34.5% 65.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 51 117 37 14 56 61
Base content per 1 kb (bases) 304 696 220 83 333 363
Base content (%) 30.4% 69.6%
COX1 (size: 1560 bases) GC AT G C A T
Base content (bases) 625 935 350 275 525 410
Base content per 1 kb (bases) 401 599 224 176 337 263
Base content (%) 40.1% 59.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 268 423 174 94 204 219
Base content per 1 kb (bases) 388 612 252 136 295 317
Base content (%) 38.8% 61.2%
COX3 (size: 790 bases) GC AT G C A T
Base content (bases) 319 471 189 130 254 217
Base content per 1 kb (bases) 404 596 239 165 322 275
Base content (%) 40.4% 59.6%
CYTB (size: 1147 bases) GC AT G C A T
Base content (bases) 432 715 282 150 386 329
Base content per 1 kb (bases) 377 623 246 131 337 287
Base content (%) 37.7% 62.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 374 601 260 114 309 292
Base content per 1 kb (bases) 384 616 267 117 317 299
Base content (%) 38.4% 61.6%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 408 638 297 111 287 351
Base content per 1 kb (bases) 390 610 284 106 274 336
Base content (%) 39.0% 61.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 143 206 100 43 118 88
Base content per 1 kb (bases) 410 590 287 123 338 252
Base content (%) 41.0% 59.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 519 862 348 171 449 413
Base content per 1 kb (bases) 376 624 252 124 325 299
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 81 45 103 68
Base content per 1 kb (bases) 424 576 273 152 347 229
Base content (%) 42.4% 57.6%
ND5 (size: 1851 bases) GC AT G C A T
Base content (bases) 683 1168 446 237 604 564
Base content per 1 kb (bases) 369 631 241 128 326 305
Base content (%) 36.9% 63.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 193 329 134 59 107 222
Base content per 1 kb (bases) 370 630 257 113 205 425
Base content (%) 37.0% 63.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 3 10 8 6 6 1 28 7 2 2 2 5 1 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 5 9 3 0 6 1 2 1 8 3 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 2 1 2 0 4 2 2 2 2 4 6 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 0 2 0 0 1 2 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 55 71 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 61 34 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 41 92 82
ATP8 (size: 168 bases)
Amino acid sequence: VPQLNTTPWLMILIFTWFVFLIFILPKVMTYIFPNEPTLKNKKTFMPWTWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 6 (10.91%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 6 (10.91%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 3 0 0 2 1 2 1 0 0 1 1 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 0 0 0 0 0 0 0 1 2 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 0 0 0 0 0 0 1 1 1 1 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 11 23 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 14 13 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 12 25 15
COX1 (size: 1560 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.86%)
Alanine (Ala, A)
n = 44 (8.48%)
Serine (Ser, S)
n = 30 (5.78%)
Threonine (Thr, T)
n = 38 (7.32%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 39 (7.51%)
Leucine (Leu, L)
n = 64 (12.33%)
Isoleucine (Ile, I)
n = 32 (6.17%)
Methionine (Met, M)
n = 30 (5.78%)
Proline (Pro, P)
n = 27 (5.2%)
Phenylalanine (Phe, F)
n = 42 (8.09%)
Tyrosine (Tyr, Y)
n = 20 (3.85%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 13 (2.5%)
Glutamic acid (Glu, E)
n = 12 (2.31%)
Asparagine (Asn, N)
n = 17 (3.28%)
Glutamine (Gln, Q)
n = 9 (1.73%)
Histidine (His, H)
n = 19 (3.66%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 10 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 6 23 12 11 11 2 22 6 3 8 3 23 5 28 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 12 16 16 0 18 9 14 5 8 10 7 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 3 12 6 6 2 2 2 14 6 2 6 10 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 11 1 11 2 7 1 3 0 6 1 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 101 130 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 135 98 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 114 182 183
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 13 (5.68%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 18 (7.86%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 14 (6.11%)
Methionine (Met, M)
n = 17 (7.42%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 11 (4.8%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 10 (4.37%)
Asparagine (Asn, N)
n = 9 (3.93%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 8 (3.49%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 16 9 0 6 0 11 8 0 2 4 9 2 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 7 2 0 1 1 5 1 5 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 1 5 4 4 0 2 2 4 6 0 0 5 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 2 5 8 3 1 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 51 66 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 62 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 91 66
COX3 (size: 790 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.25%)
Alanine (Ala, A)
n = 17 (6.49%)
Serine (Ser, S)
n = 21 (8.02%)
Threonine (Thr, T)
n = 26 (9.92%)
Cysteine (Cys, C)
n = 2 (0.76%)
Valine (Val, V)
n = 14 (5.34%)
Leucine (Leu, L)
n = 37 (14.12%)
Isoleucine (Ile, I)
n = 19 (7.25%)
Methionine (Met, M)
n = 9 (3.44%)
Proline (Pro, P)
n = 14 (5.34%)
Phenylalanine (Phe, F)
n = 16 (6.11%)
Tyrosine (Tyr, Y)
n = 10 (3.82%)
Tryptophan (Trp, W)
n = 8 (3.05%)
Aspartic acid (Asp, D)
n = 8 (3.05%)
Glutamic acid (Glu, E)
n = 8 (3.05%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 11 (4.2%)
Histidine (His, H)
n = 11 (4.2%)
Lysine (Lys, K)
n = 4 (1.53%)
Arginine (Arg, R)
n = 5 (1.91%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 3 4 12 3 5 1 11 9 2 3 4 7 0 10 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 8 3 5 1 6 3 8 2 4 5 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 16 0 4 4 7 1 3 2 6 4 2 5 2 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 4 5 3 3 1 0 0 5 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 62 67 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 73 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 54 94 90
CYTB (size: 1147 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.56%)
Alanine (Ala, A)
n = 24 (6.3%)
Serine (Ser, S)
n = 24 (6.3%)
Threonine (Thr, T)
n = 24 (6.3%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.25%)
Leucine (Leu, L)
n = 61 (16.01%)
Isoleucine (Ile, I)
n = 35 (9.19%)
Methionine (Met, M)
n = 15 (3.94%)
Proline (Pro, P)
n = 21 (5.51%)
Phenylalanine (Phe, F)
n = 31 (8.14%)
Tyrosine (Tyr, Y)
n = 14 (3.67%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 20 (5.25%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 13 (3.41%)
Lysine (Lys, K)
n = 9 (2.36%)
Arginine (Arg, R)
n = 8 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 12 11 10 6 20 2 20 6 1 7 3 10 0 18 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 4 14 6 0 7 2 12 4 5 7 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 0 8 2 12 0 0 2 10 4 0 3 8 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 6 5 8 1 3 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 87 105 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 91 80 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 104 144 119
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 23 (7.1%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.4%)
Leucine (Leu, L)
n = 51 (15.74%)
Isoleucine (Ile, I)
n = 29 (8.95%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 34 (10.49%)
Phenylalanine (Phe, F)
n = 27 (8.33%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 7 (2.16%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 8 (2.47%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 10 (3.09%)
Arginine (Arg, R)
n = 6 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 10 11 7 4 20 0 20 8 0 3 2 5 1 22 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 5 11 7 0 3 1 10 5 6 15 11 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 4 6 8 0 1 2 9 4 0 0 7 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 1 2 10 0 2 1 2 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 84 88 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 96 64 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 80 140 93
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 29 (8.36%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 24 9 12 22 3 19 14 0 1 0 3 1 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 12 12 0 5 6 5 2 3 7 12 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 7 2 8 0 2 4 4 3 0 1 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 1 0 9 1 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 91 129 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 116 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 90 166 80
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 29 (8.36%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 24 9 12 22 3 19 14 0 1 0 3 1 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 12 12 0 5 6 5 2 3 7 12 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 7 2 8 0 2 4 4 3 0 1 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 1 0 9 1 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 91 129 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 116 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 90 166 80
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.45%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 44 (9.59%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 94 (20.48%)
Isoleucine (Ile, I)
n = 48 (10.46%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 17 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 15 23 20 9 24 2 36 10 0 4 2 5 0 14 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 5 7 11 15 0 11 7 5 2 7 9 5 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 1 4 8 6 0 3 6 9 8 5 3 6 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 0 3 9 1 2 3 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 113 151 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 119 76 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 116 186 136
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 9 (9.18%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 7 2 6 1 6 3 0 2 0 1 0 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 5 4 4 0 1 3 0 1 2 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 0 5 1 1 2 1 0 0 0 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 2 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 27 19 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 30 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 24 35 35
ND5 (size: 1851 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.55%)
Alanine (Ala, A)
n = 50 (8.12%)
Serine (Ser, S)
n = 43 (6.98%)
Threonine (Thr, T)
n = 42 (6.82%)
Cysteine (Cys, C)
n = 9 (1.46%)
Valine (Val, V)
n = 31 (5.03%)
Leucine (Leu, L)
n = 87 (14.12%)
Isoleucine (Ile, I)
n = 67 (10.88%)
Methionine (Met, M)
n = 37 (6.01%)
Proline (Pro, P)
n = 35 (5.68%)
Phenylalanine (Phe, F)
n = 43 (6.98%)
Tyrosine (Tyr, Y)
n = 19 (3.08%)
Tryptophan (Trp, W)
n = 10 (1.62%)
Aspartic acid (Asp, D)
n = 14 (2.27%)
Glutamic acid (Glu, E)
n = 9 (1.46%)
Asparagine (Asn, N)
n = 22 (3.57%)
Glutamine (Gln, Q)
n = 17 (2.76%)
Histidine (His, H)
n = 15 (2.44%)
Lysine (Lys, K)
n = 26 (4.22%)
Arginine (Arg, R)
n = 12 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
48 19 31 13 12 19 5 35 16 1 7 3 18 3 27 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 5 17 18 15 0 6 9 9 4 6 12 13 4 19
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 2 8 6 15 1 3 10 12 7 2 3 4 18 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 7 7 25 1 1 2 8 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
132 128 207 150
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 157 123 265
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 161 234 189
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 14 (8.09%)
Serine (Ser, S)
n = 14 (8.09%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 21 (12.14%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 18 (10.4%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 2 5 1 0 3 1 12 0 0 9 1 7 4 17 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 0 6 0 9 1 5 7 2 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 6 0 4 0 4 0 4 3 3 10 3 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 1 2 1 1 0 0 1 2 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 14 32 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 32 23 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 13 52 74
Total protein-coding genes (size: 11461 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 231 (6.05%)
Alanine (Ala, A)
n = 283 (7.41%)
Serine (Ser, S)
n = 249 (6.52%)
Threonine (Thr, T)
n = 310 (8.12%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 186 (4.87%)
Leucine (Leu, L)
n = 620 (16.24%)
Isoleucine (Ile, I)
n = 321 (8.41%)
Methionine (Met, M)
n = 202 (5.29%)
Proline (Pro, P)
n = 230 (6.03%)
Phenylalanine (Phe, F)
n = 257 (6.73%)
Tyrosine (Tyr, Y)
n = 127 (3.33%)
Tryptophan (Trp, W)
n = 106 (2.78%)
Aspartic acid (Asp, D)
n = 76 (1.99%)
Glutamic acid (Glu, E)
n = 90 (2.36%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 99 (2.59%)
Histidine (His, H)
n = 100 (2.62%)
Lysine (Lys, K)
n = 91 (2.38%)
Arginine (Arg, R)
n = 73 (1.91%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
227 94 165 113 70 149 20 232 90 9 49 25 94 18 178 79
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 13 17 82 109 91 1 73 46 77 35 60 79 79 12 80
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 131 8 62 42 81 5 25 34 78 49 18 36 61 69 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 75 15 41 35 82 9 13 11 42 7 0 1 6 0 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
866 854 1114 984
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
500 1013 719 1586
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
231 913 1482 1192

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.