Viewing data for Chelodina longicollis


Scientific name Chelodina longicollis
Common name Common snakeneck turtle
Maximum lifespan 37.00 years (Chelodina longicollis@AnAge)

Total mtDNA (size: 16647 bases) GC AT G C A T
Base content (bases) 6289 10358 4156 2133 4414 5944
Base content per 1 kb (bases) 378 622 250 128 265 357
Base content (%) 37.8% 62.2%
Total protein-coding genes (size: 11287 bases) GC AT G C A T
Base content (bases) 4306 6981 2994 1312 3033 3948
Base content per 1 kb (bases) 382 618 265 116 269 350
Base content (%) 38.2% 61.8%
D-loop (size: 1090 bases) GC AT G C A T
Base content (bases) 355 735 200 155 367 368
Base content per 1 kb (bases) 326 674 183 142 337 338
Base content (%) 32.6% 67.4%
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 582 960 353 229 401 559
Base content per 1 kb (bases) 377 623 229 149 260 363
Base content (%) 37.7% 62.3%
Total rRNA-coding genes (size: 2570 bases) GC AT G C A T
Base content (bases) 992 1578 563 429 582 996
Base content per 1 kb (bases) 386 614 219 167 226 388
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 971 bases) GC AT G C A T
Base content (bases) 391 580 227 164 221 359
Base content per 1 kb (bases) 403 597 234 169 228 370
Base content (%) 40.3% 59.7%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 601 998 336 265 361 637
Base content per 1 kb (bases) 376 624 210 166 226 398
Base content (%) 37.6% 62.4%

ATP6 (size: 687 bases) GC AT G C A T
Base content (bases) 251 436 184 67 195 241
Base content per 1 kb (bases) 365 635 268 98 284 351
Base content (%) 36.5% 63.5%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 55 107 44 11 34 73
Base content per 1 kb (bases) 340 660 272 68 210 451
Base content (%) 34.0% 66.0%
COX1 (size: 1539 bases) GC AT G C A T
Base content (bases) 623 916 382 241 432 484
Base content per 1 kb (bases) 405 595 248 157 281 314
Base content (%) 40.5% 59.5%
COX2 (size: 679 bases) GC AT G C A T
Base content (bases) 261 418 172 89 176 242
Base content per 1 kb (bases) 384 616 253 131 259 356
Base content (%) 38.4% 61.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 316 468 203 113 214 254
Base content per 1 kb (bases) 403 597 259 144 273 324
Base content (%) 40.3% 59.7%
CYTB (size: 1129 bases) GC AT G C A T
Base content (bases) 446 683 317 129 309 374
Base content per 1 kb (bases) 395 605 281 114 274 331
Base content (%) 39.5% 60.5%
ND1 (size: 965 bases) GC AT G C A T
Base content (bases) 368 597 256 112 287 310
Base content per 1 kb (bases) 381 619 265 116 297 321
Base content (%) 38.1% 61.9%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 404 640 290 114 277 363
Base content per 1 kb (bases) 387 613 278 109 265 348
Base content (%) 38.7% 61.3%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 122 224 83 39 105 119
Base content per 1 kb (bases) 353 647 240 113 303 344
Base content (%) 35.3% 64.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 508 873 372 136 384 489
Base content per 1 kb (bases) 368 632 269 98 278 354
Base content (%) 36.8% 63.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 118 179 86 32 84 95
Base content per 1 kb (bases) 397 603 290 108 283 320
Base content (%) 39.7% 60.3%
ND5 (size: 1767 bases) GC AT G C A T
Base content (bases) 652 1115 464 188 456 659
Base content per 1 kb (bases) 369 631 263 106 258 373
Base content (%) 36.9% 63.1%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 186 342 143 43 86 256
Base content per 1 kb (bases) 352 648 271 81 163 485
Base content (%) 35.2% 64.8%

ATP6 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 13 (5.7%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 23 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 48 (21.05%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 17 (7.46%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 4 (1.75%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.75%)
Asparagine (Asn, N)
n = 11 (4.82%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 13 2 0 30 1 15 7 2 2 1 9 0 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 3 4 0 2 2 3 1 0 3 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 0 4 2 6 0 0 3 1 1 0 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 3 0 2 1 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 67 80 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 65 35 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 52 126 43
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPDPWLSIMCTSWLIYMIVQPKIKSHLTINSTTNKPKKTKKQTWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.55%)
Threonine (Thr, T)
n = 8 (15.09%)
Cysteine (Cys, C)
n = 1 (1.89%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 4 (7.55%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 6 (11.32%)
Phenylalanine (Phe, F)
n = 0 (0%)
Tyrosine (Tyr, Y)
n = 1 (1.89%)
Tryptophan (Trp, W)
n = 5 (9.43%)
Aspartic acid (Asp, D)
n = 1 (1.89%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.66%)
Glutamine (Gln, Q)
n = 3 (5.66%)
Histidine (His, H)
n = 1 (1.89%)
Lysine (Lys, K)
n = 7 (13.21%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 1 0 2 0 1 3 0 0 0 1 0 0 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 0 0 0 0 0 0 0 0 0 1 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 0 1 0 0 1 1 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 7 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 13 27 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 17 17 13
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 14 29 9
COX1 (size: 1539 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.98%)
Alanine (Ala, A)
n = 43 (8.4%)
Serine (Ser, S)
n = 34 (6.64%)
Threonine (Thr, T)
n = 34 (6.64%)
Cysteine (Cys, C)
n = 1 (0.2%)
Valine (Val, V)
n = 32 (6.25%)
Leucine (Leu, L)
n = 60 (11.72%)
Isoleucine (Ile, I)
n = 42 (8.2%)
Methionine (Met, M)
n = 37 (7.23%)
Proline (Pro, P)
n = 29 (5.66%)
Phenylalanine (Phe, F)
n = 36 (7.03%)
Tyrosine (Tyr, Y)
n = 18 (3.52%)
Tryptophan (Trp, W)
n = 17 (3.32%)
Aspartic acid (Asp, D)
n = 15 (2.93%)
Glutamic acid (Glu, E)
n = 9 (1.76%)
Asparagine (Asn, N)
n = 17 (3.32%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 17 (3.32%)
Lysine (Lys, K)
n = 9 (1.76%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 32 7 4 29 1 16 7 1 4 6 20 2 18 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 10 15 18 0 10 9 21 6 4 4 21 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 0 5 3 21 0 1 4 7 11 1 3 4 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 6 9 9 0 1 1 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
145 103 144 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 135 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 144 246 104
COX2 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.11%)
Alanine (Ala, A)
n = 10 (4.44%)
Serine (Ser, S)
n = 18 (8.0%)
Threonine (Thr, T)
n = 18 (8.0%)
Cysteine (Cys, C)
n = 2 (0.89%)
Valine (Val, V)
n = 11 (4.89%)
Leucine (Leu, L)
n = 27 (12.0%)
Isoleucine (Ile, I)
n = 20 (8.89%)
Methionine (Met, M)
n = 17 (7.56%)
Proline (Pro, P)
n = 14 (6.22%)
Phenylalanine (Phe, F)
n = 8 (3.56%)
Tyrosine (Tyr, Y)
n = 9 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.22%)
Aspartic acid (Asp, D)
n = 10 (4.44%)
Glutamic acid (Glu, E)
n = 15 (6.67%)
Asparagine (Asn, N)
n = 7 (3.11%)
Glutamine (Gln, Q)
n = 11 (4.89%)
Histidine (His, H)
n = 10 (4.44%)
Lysine (Lys, K)
n = 3 (1.33%)
Arginine (Arg, R)
n = 4 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 8 12 5 2 10 2 8 11 0 2 2 6 1 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 0 5 5 0 0 3 4 0 3 2 9 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 2 0 3 11 0 2 2 3 6 0 0 3 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 2 5 5 2 1 0 0 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 58 69 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 56 65 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 58 108 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 14 (5.38%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 13 3 1 11 2 10 10 0 5 2 8 0 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 10 5 0 2 1 11 5 0 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 3 2 6 0 2 3 3 9 0 0 1 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 2 1 3 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 57 71 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 65 58 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 81 125 47
CYTB (size: 1129 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.4%)
Alanine (Ala, A)
n = 17 (4.53%)
Serine (Ser, S)
n = 26 (6.93%)
Threonine (Thr, T)
n = 26 (6.93%)
Cysteine (Cys, C)
n = 3 (0.8%)
Valine (Val, V)
n = 15 (4.0%)
Leucine (Leu, L)
n = 64 (17.07%)
Isoleucine (Ile, I)
n = 36 (9.6%)
Methionine (Met, M)
n = 18 (4.8%)
Proline (Pro, P)
n = 24 (6.4%)
Phenylalanine (Phe, F)
n = 25 (6.67%)
Tyrosine (Tyr, Y)
n = 17 (4.53%)
Tryptophan (Trp, W)
n = 10 (2.67%)
Aspartic acid (Asp, D)
n = 10 (2.67%)
Glutamic acid (Glu, E)
n = 4 (1.07%)
Asparagine (Asn, N)
n = 20 (5.33%)
Glutamine (Gln, Q)
n = 9 (2.4%)
Histidine (His, H)
n = 11 (2.93%)
Lysine (Lys, K)
n = 10 (2.67%)
Arginine (Arg, R)
n = 7 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 16 3 8 41 2 10 9 0 3 0 11 1 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 6 8 3 0 4 2 15 3 2 3 19 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 1 3 6 12 2 2 1 4 13 1 0 6 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 3 7 10 0 0 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 105 113 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 90 81 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 122 180 62
ND1 (size: 965 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 20 (6.25%)
Serine (Ser, S)
n = 31 (9.69%)
Threonine (Thr, T)
n = 20 (6.25%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.13%)
Leucine (Leu, L)
n = 59 (18.44%)
Isoleucine (Ile, I)
n = 25 (7.81%)
Methionine (Met, M)
n = 23 (7.19%)
Proline (Pro, P)
n = 24 (7.5%)
Phenylalanine (Phe, F)
n = 20 (6.25%)
Tyrosine (Tyr, Y)
n = 13 (4.06%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 12 (3.75%)
Glutamine (Gln, Q)
n = 7 (2.19%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.5%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 21 3 7 30 3 16 7 0 2 1 5 2 11 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 10 6 0 4 1 10 1 2 3 16 3 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 1 6 8 14 0 0 3 6 7 1 0 6 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 3 7 1 0 0 7 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 83 91 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 92 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 81 161 63
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 70 (20.17%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 30 (8.65%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 12 (3.46%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 23 8 8 31 4 17 13 1 1 1 6 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 6 9 7 0 2 3 5 4 2 4 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 2 6 5 12 1 2 4 3 5 1 2 1 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 0 1 10 3 0 0 3 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 100 123 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 104 66 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 86 174 61
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 70 (20.17%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 30 (8.65%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 12 (3.46%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 23 8 8 31 4 17 13 1 1 1 6 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 6 9 7 0 2 3 5 4 2 4 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 2 6 5 12 1 2 4 3 5 1 2 1 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 0 1 10 3 0 0 3 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 100 123 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 104 66 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 86 174 61
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.79%)
Alanine (Ala, A)
n = 23 (5.01%)
Serine (Ser, S)
n = 40 (8.71%)
Threonine (Thr, T)
n = 54 (11.76%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 50 (10.89%)
Methionine (Met, M)
n = 40 (8.71%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 18 36 6 6 44 5 24 12 2 2 1 2 1 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 5 11 7 0 3 6 11 2 2 3 16 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 26 0 3 8 18 0 2 9 7 8 0 0 5 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 2 0 11 0 1 1 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 119 182 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 130 75 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 123 232 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 8 3 2 9 1 5 3 1 0 0 1 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 3 0 4 3 0 1 1 2 1 1 1 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 0 2 7 0 2 0 1 1 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 1 0 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 29 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 27 49 20
ND5 (size: 1767 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (3.74%)
Alanine (Ala, A)
n = 40 (6.8%)
Serine (Ser, S)
n = 37 (6.29%)
Threonine (Thr, T)
n = 66 (11.22%)
Cysteine (Cys, C)
n = 7 (1.19%)
Valine (Val, V)
n = 18 (3.06%)
Leucine (Leu, L)
n = 96 (16.33%)
Isoleucine (Ile, I)
n = 47 (7.99%)
Methionine (Met, M)
n = 50 (8.5%)
Proline (Pro, P)
n = 27 (4.59%)
Phenylalanine (Phe, F)
n = 25 (4.25%)
Tyrosine (Tyr, Y)
n = 20 (3.4%)
Tryptophan (Trp, W)
n = 11 (1.87%)
Aspartic acid (Asp, D)
n = 14 (2.38%)
Glutamic acid (Glu, E)
n = 12 (2.04%)
Asparagine (Asn, N)
n = 24 (4.08%)
Glutamine (Gln, Q)
n = 18 (3.06%)
Histidine (His, H)
n = 17 (2.89%)
Lysine (Lys, K)
n = 26 (4.42%)
Arginine (Arg, R)
n = 11 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 26 43 9 8 52 2 24 18 0 2 3 11 2 11 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 6 7 12 20 1 5 3 11 3 2 3 21 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 37 2 1 9 22 0 2 3 6 14 2 1 16 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 2 4 10 24 2 2 2 6 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 144 218 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 165 132 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 155 309 99
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 4 (2.29%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 29 (16.57%)
Isoleucine (Ile, I)
n = 13 (7.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 18 (10.29%)
Tyrosine (Tyr, Y)
n = 8 (4.57%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 3 (1.71%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 1 4 0 1 0 10 0 0 13 1 7 4 17 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 6 0 1 1 11 0 3 8 3 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 7 0 1 2 2 1 7 1 4 14 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 5 0 2 0 3 0 1 0 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 12 34 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 22 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 6 30 97
Total protein-coding genes (size: 11308 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.55%)
Alanine (Ala, A)
n = 228 (6.05%)
Serine (Ser, S)
n = 282 (7.49%)
Threonine (Thr, T)
n = 335 (8.9%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 158 (4.2%)
Leucine (Leu, L)
n = 616 (16.36%)
Isoleucine (Ile, I)
n = 317 (8.42%)
Methionine (Met, M)
n = 271 (7.2%)
Proline (Pro, P)
n = 208 (5.52%)
Phenylalanine (Phe, F)
n = 201 (5.34%)
Tyrosine (Tyr, Y)
n = 127 (3.37%)
Tryptophan (Trp, W)
n = 106 (2.81%)
Aspartic acid (Asp, D)
n = 70 (1.86%)
Glutamic acid (Glu, E)
n = 87 (2.31%)
Asparagine (Asn, N)
n = 141 (3.74%)
Glutamine (Gln, Q)
n = 109 (2.89%)
Histidine (His, H)
n = 102 (2.71%)
Lysine (Lys, K)
n = 97 (2.58%)
Arginine (Arg, R)
n = 68 (1.81%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
171 146 225 56 49 301 24 166 102 7 36 18 91 13 101 100
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 8 20 56 87 83 2 44 31 100 34 21 30 150 7 37
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
124 164 10 41 51 134 5 17 34 50 77 10 20 51 90 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 77 10 30 40 90 7 9 5 51 3 0 1 6 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
752 917 1213 885
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 1002 739 1563
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
199 977 1836 755

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.