Viewing data for Arenaria interpres


Scientific name Arenaria interpres
Common name Ruddy turnstone
Maximum lifespan 22.30 years (Arenaria interpres@AnAge)

Total mtDNA (size: 16725 bases) GC AT G C A T
Base content (bases) 7469 9256 5138 2331 4132 5124
Base content per 1 kb (bases) 447 553 307 139 247 306
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5128 6251 3709 1419 2838 3413
Base content per 1 kb (bases) 451 549 326 125 249 300
Base content (%) 45.1% 54.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1560 bases) GC AT G C A T
Base content (bases) 655 905 393 262 400 505
Base content per 1 kb (bases) 420 580 252 168 256 324
Base content (%) 42.0% 58.0%
Total rRNA-coding genes (size: 2565 bases) GC AT G C A T
Base content (bases) 1147 1418 660 487 570 848
Base content per 1 kb (bases) 447 553 257 190 222 331
Base content (%) 44.7% 55.3%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 459 511 263 196 210 301
Base content per 1 kb (bases) 473 527 271 202 216 310
Base content (%) 47.3% 52.7%
16S rRNA gene (size: 1595 bases) GC AT G C A T
Base content (bases) 688 907 397 291 360 547
Base content per 1 kb (bases) 431 569 249 182 226 343
Base content (%) 43.1% 56.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 245 66 185 188
Base content per 1 kb (bases) 455 545 358 96 270 275
Base content (%) 45.5% 54.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 71 97 61 10 43 54
Base content per 1 kb (bases) 423 577 363 60 256 321
Base content (%) 42.3% 57.7%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 717 834 465 252 413 421
Base content per 1 kb (bases) 462 538 300 162 266 271
Base content (%) 46.2% 53.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 310 374 206 104 170 204
Base content per 1 kb (bases) 453 547 301 152 249 298
Base content (%) 45.3% 54.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 365 419 239 126 200 219
Base content per 1 kb (bases) 466 534 305 161 255 279
Base content (%) 46.6% 53.4%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 533 610 390 143 279 331
Base content per 1 kb (bases) 466 534 341 125 244 290
Base content (%) 46.6% 53.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 437 541 307 130 273 268
Base content per 1 kb (bases) 447 553 314 133 279 274
Base content (%) 44.7% 55.3%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 444 597 336 108 266 331
Base content per 1 kb (bases) 427 573 323 104 256 318
Base content (%) 42.7% 57.3%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 161 191 119 42 88 103
Base content per 1 kb (bases) 457 543 338 119 250 293
Base content (%) 45.7% 54.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 623 755 480 143 329 426
Base content per 1 kb (bases) 452 548 348 104 239 309
Base content (%) 45.2% 54.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 138 159 96 42 83 76
Base content per 1 kb (bases) 465 535 323 141 279 256
Base content (%) 46.5% 53.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 792 1023 584 208 443 580
Base content per 1 kb (bases) 436 564 322 115 244 320
Base content (%) 43.6% 56.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 231 291 184 47 70 221
Base content per 1 kb (bases) 443 557 352 90 134 423
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 7 9 16 25 2 10 8 0 2 2 2 0 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 12 5 0 2 4 1 1 6 5 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 0 2 4 3 0 1 4 1 2 0 0 1 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 2 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 86 66 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 68 34 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 88 44
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLASWLTFSLIIQPKLLSLTPTNPPSNKTSTTTKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 1 1 1 3 0 1 1 1 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 4 3 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 1 0 1 1 2 1 0 0 0 0 0 1 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 16 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 10 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 21 12
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 43 (8.33%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 22 7 12 33 3 5 8 1 4 12 18 1 10 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 11 23 10 1 10 15 18 4 3 10 13 4 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 1 3 9 11 0 0 3 8 10 0 2 1 14 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 6 9 8 1 0 4 4 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 121 136 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 95 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 203 190 101
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 13 (5.73%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 7 3 10 13 3 3 7 0 4 5 5 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 7 5 0 1 2 4 1 6 2 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 2 5 10 0 0 4 5 3 1 0 0 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 0 12 4 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 63 54 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 61 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 85 89 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 7 2 7 15 3 6 8 0 2 6 6 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 2 7 10 3 3 7 8 3 2 4 6 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 2 5 8 0 0 4 4 6 1 0 1 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 3 4 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 68 56 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 104 109 34
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 25 9 8 13 33 3 8 7 1 0 7 8 2 2 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 3 14 7 3 4 8 13 0 4 9 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 0 2 7 11 1 0 1 1 13 0 0 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 0 6 9 1 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 110 100 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 101 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 179 152 38
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 24 (7.38%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 26 (8.0%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 23 (7.08%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 8 (2.46%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 8 11 12 25 0 13 4 1 1 2 8 2 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 8 11 9 1 3 4 5 1 3 6 13 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 0 4 10 7 1 2 3 2 13 2 2 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 5 2 2 7 1 1 3 4 0 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 87 88 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 98 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 122 122 60
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 33 (9.54%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 20 (5.78%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 9 (2.6%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 24 17 10 13 26 6 6 8 1 0 4 1 1 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 8 12 13 0 3 3 5 2 2 5 13 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 0 7 5 12 1 3 1 3 7 1 2 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 13 1 0 1 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 96 125 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 61 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 119 145 63
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 33 (9.54%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 20 (5.78%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 9 (2.6%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 24 17 10 13 26 6 6 8 1 0 4 1 1 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 8 12 13 0 3 3 5 2 2 5 13 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 0 7 5 12 1 3 1 3 7 1 2 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 13 1 0 1 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 96 125 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 61 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 119 145 63
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 47 (10.26%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 26 4 22 53 9 11 11 1 2 5 3 0 1 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 6 17 10 0 2 6 8 2 2 12 14 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 13 1 3 12 10 1 3 6 3 12 0 0 4 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 0 2 7 1 0 3 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 154 151 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 134 80 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 192 195 55
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 1 4 10 1 6 2 0 0 1 2 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 3 4 2 1 1 2 1 0 0 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 2 5 3 0 1 3 0 2 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 29 22 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 28 18 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 39 36 16
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.63%)
Alanine (Ala, A)
n = 47 (7.78%)
Serine (Ser, S)
n = 48 (7.95%)
Threonine (Thr, T)
n = 79 (13.08%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 12 (1.99%)
Leucine (Leu, L)
n = 101 (16.72%)
Isoleucine (Ile, I)
n = 53 (8.77%)
Methionine (Met, M)
n = 34 (5.63%)
Proline (Pro, P)
n = 29 (4.8%)
Phenylalanine (Phe, F)
n = 32 (5.3%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 23 (3.81%)
Glutamine (Gln, Q)
n = 19 (3.15%)
Histidine (His, H)
n = 10 (1.66%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 34 28 11 24 46 4 15 17 2 3 5 2 2 8 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 14 22 11 0 1 11 21 1 4 10 15 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
35 28 2 6 13 16 1 0 12 3 12 0 1 5 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 0 0 8 19 2 0 5 4 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 152 223 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 191 109 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 241 248 95
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 33 (19.08%)
Leucine (Leu, L)
n = 25 (14.45%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 0 0 0 1 7 0 0 16 0 7 10 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 4 2 3 2 7 1 5 15 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 7 2 1 1 4 1 7 0 1 17 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 4 0 0 1 2 0 2 1 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 10 22 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 29 17 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 8 31 76
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 301 (7.93%)
Serine (Ser, S)
n = 284 (7.48%)
Threonine (Thr, T)
n = 347 (9.14%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 168 (4.42%)
Leucine (Leu, L)
n = 661 (17.41%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 178 (4.69%)
Proline (Pro, P)
n = 220 (5.79%)
Phenylalanine (Phe, F)
n = 220 (5.79%)
Tyrosine (Tyr, Y)
n = 119 (3.13%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 131 (3.45%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 86 (2.26%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
102 188 140 67 144 298 35 92 84 8 34 50 64 20 54 166
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 10 20 64 135 91 11 37 64 93 30 41 70 102 7 71
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
151 119 6 42 81 97 7 15 42 38 81 6 25 23 108 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 81 12 14 48 78 8 6 25 38 2 1 2 6 2 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
848 1031 1092 827
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
491 1095 695 1517
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
219 1448 1484 647

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.