Viewing data for Ursus americanus


Scientific name Ursus americanus
Common name American black bear
Maximum lifespan 34.00 years (Ursus americanus@AnAge)

Total mtDNA (size: 16841 bases) GC AT G C A T
Base content (bases) 6837 10004 4223 2614 4760 5244
Base content per 1 kb (bases) 406 594 251 155 283 311
Base content (%) 40.6% 59.4%
Total protein-coding genes (size: 11342 bases) GC AT G C A T
Base content (bases) 4643 6699 3045 1598 3259 3440
Base content per 1 kb (bases) 409 591 268 141 287 303
Base content (%) 40.9% 59.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1507 bases) GC AT G C A T
Base content (bases) 550 957 307 243 426 531
Base content per 1 kb (bases) 365 635 204 161 283 352
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2545 bases) GC AT G C A T
Base content (bases) 1025 1520 548 477 616 904
Base content per 1 kb (bases) 403 597 215 187 242 355
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 965 bases) GC AT G C A T
Base content (bases) 406 559 219 187 224 335
Base content per 1 kb (bases) 421 579 227 194 232 347
Base content (%) 42.1% 57.9%
16S rRNA gene (size: 1580 bases) GC AT G C A T
Base content (bases) 619 961 329 290 392 569
Base content per 1 kb (bases) 392 608 208 184 248 360
Base content (%) 39.2% 60.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 285 396 188 97 207 189
Base content per 1 kb (bases) 419 581 276 142 304 278
Base content (%) 41.9% 58.1%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 52 19 55 78
Base content per 1 kb (bases) 348 652 255 93 270 382
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 643 902 353 290 492 410
Base content per 1 kb (bases) 416 584 228 188 318 265
Base content (%) 41.6% 58.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 273 411 168 105 184 227
Base content per 1 kb (bases) 399 601 246 154 269 332
Base content (%) 39.9% 60.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 338 446 206 132 238 208
Base content per 1 kb (bases) 431 569 263 168 304 265
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 500 640 338 162 310 330
Base content per 1 kb (bases) 439 561 296 142 272 289
Base content (%) 43.9% 56.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 404 553 275 129 270 283
Base content per 1 kb (bases) 422 578 287 135 282 296
Base content (%) 42.2% 57.8%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 407 637 293 114 287 350
Base content per 1 kb (bases) 390 610 281 109 275 335
Base content (%) 39.0% 61.0%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 147 200 96 51 102 98
Base content per 1 kb (bases) 424 576 277 147 294 282
Base content (%) 42.4% 57.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 579 799 399 180 382 417
Base content per 1 kb (bases) 420 580 290 131 277 303
Base content (%) 42.0% 58.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 72 43 101 81
Base content per 1 kb (bases) 387 613 242 145 340 273
Base content (%) 38.7% 61.3%
ND5 (size: 1829 bases) GC AT G C A T
Base content (bases) 701 1128 476 225 546 582
Base content per 1 kb (bases) 383 617 260 123 299 318
Base content (%) 38.3% 61.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 206 322 147 59 109 213
Base content per 1 kb (bases) 390 610 278 112 206 403
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 17 (7.52%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 5 6 3 17 6 4 6 2 2 3 6 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 6 6 3 0 2 2 6 1 7 3 2 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 3 2 4 1 3 4 0 3 1 6 4 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 0 2 2 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 65 81 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 35 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 60 73 65
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSAWSITILSMVLALFIMFQLKVSKYKYPEIPEPKPLSSPKKPMPWEEKWTKVCSPLLLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 3 (4.48%)
Cysteine (Cys, C)
n = 1 (1.49%)
Valine (Val, V)
n = 3 (4.48%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 10 (14.93%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 4 (5.97%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 3 1 1 4 0 3 4 0 2 1 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 0 0 2 0 0 0 0 0 5 2 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 2 0 5 0 0 0 1 1 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 1 0 1 6 2 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 20 19 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 20 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 10 39 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 35 (6.81%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 22 12 3 18 11 11 4 2 6 9 14 8 21 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 1 0 10 13 16 2 7 7 19 14 10 9 8 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 2 15 1 12 0 1 2 11 8 2 3 13 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 5 8 6 8 1 1 0 6 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 104 140 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 115 175 160
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 18 (7.93%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 10 1 6 14 4 7 7 0 1 3 6 2 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 1 2 2 5 0 1 3 3 1 3 3 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 2 2 5 7 1 1 2 6 4 1 1 4 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 7 3 4 1 1 0 3 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 59 68 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 56 63 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 53 96 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 7 6 9 4 13 1 3 6 1 3 5 6 4 13 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 0 5 10 1 3 4 11 1 2 1 7 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 1 3 4 10 0 3 3 6 5 3 3 3 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 3 2 1 1 1 0 1 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 67 57 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 53 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 73 98 66
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 28 6 5 10 34 5 3 5 1 3 3 6 3 11 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 6 10 9 0 1 7 15 3 3 10 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 1 7 4 11 1 0 2 6 8 1 2 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 5 6 7 2 0 0 6 2 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 104 109 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 99 75 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 135 146 73
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 27 (8.49%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.97%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 22 (6.92%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 11 (3.46%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 13 4 10 32 5 4 4 2 1 7 9 2 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 12 9 1 1 4 7 0 6 10 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 1 4 1 11 1 1 3 8 4 0 0 3 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 2 7 0 2 1 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 91 91 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 94 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 90 137 70
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 29 (8.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 25 7 8 33 3 4 6 2 1 8 6 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 4 10 9 1 2 7 6 1 4 9 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 1 4 9 13 1 0 2 5 5 0 0 5 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 1 14 0 1 0 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 89 132 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 102 60 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 102 158 67
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 29 (8.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 25 7 8 33 3 4 6 2 1 8 6 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 4 10 9 1 2 7 6 1 4 9 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 1 4 9 13 1 0 2 5 5 0 0 5 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 1 14 0 1 0 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 89 132 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 102 60 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 102 158 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 37 (8.08%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 34 (7.42%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 30 15 14 42 12 11 10 2 2 3 7 3 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 1 4 18 11 4 0 9 8 1 6 10 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 2 7 11 5 1 8 6 4 13 1 1 7 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 2 3 1 9 4 0 1 8 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 136 153 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 120 82 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 143 182 94
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 11 (11.22%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 4 2 2 9 3 6 2 0 2 3 5 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 4 1 1 1 0 2 1 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 4 3 0 0 0 0 2 2 0 0 2 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 23 25 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 21 19 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 28 37 24
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.95%)
Alanine (Ala, A)
n = 48 (7.92%)
Serine (Ser, S)
n = 45 (7.43%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 59 (9.74%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 32 (5.28%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 28 32 15 13 35 7 15 18 3 4 2 12 0 18 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 3 11 19 17 1 1 6 13 10 8 5 11 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 4 10 11 11 1 4 8 13 7 1 0 17 15 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 4 4 6 22 1 1 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
117 139 219 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 159 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 174 229 163
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 20 (11.43%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 2 3 3 0 3 0 8 1 0 7 6 6 5 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 4 3 0 2 9 3 5 8 1 2 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 3 7 0 1 0 5 0 8 1 2 6 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 1 3 1 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 11 43 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 28 31 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 20 35 82
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.76%)
Alanine (Ala, A)
n = 274 (7.21%)
Serine (Ser, S)
n = 281 (7.39%)
Threonine (Thr, T)
n = 300 (7.89%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 202 (5.31%)
Leucine (Leu, L)
n = 594 (15.63%)
Isoleucine (Ile, I)
n = 316 (8.31%)
Methionine (Met, M)
n = 242 (6.37%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 238 (6.26%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 145 (3.81%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 101 (2.66%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
167 149 164 83 79 265 61 83 75 15 35 53 84 30 117 121
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
78 9 15 56 106 99 13 29 52 96 42 57 68 69 6 82
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
71 127 20 70 52 91 8 26 34 72 62 12 23 66 79 41
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
56 68 30 37 31 86 15 7 8 44 6 1 0 8 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
861 940 1165 836
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
473 995 742 1592
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
360 1036 1452 954

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.